KEGG   Drosophila melanogaster (fruit fly): Dmel_CG32146
Entry
Dmel_CG32146      CDS       T00030                                 

Gene name
dlp
Definition
(RefSeq) dally-like, isoform A
  KO
K08110  glypican 4
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    Dmel_CG32146 (dlp)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:dme00535]
    Dmel_CG32146 (dlp)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dme00537]
    Dmel_CG32146 (dlp)
Proteoglycans [BR:dme00535]
 Cell surface proteoglycans
  Glypican family (GPI-anchored HSPG)
   Dmel_CG32146 (dlp)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dme00537]
 Others
  Dmel_CG32146 (dlp)
Motif
Pfam: Glypican DUF4799 RseC_MucC
Other DBs
NCBI-GeneID: 39596
NCBI-ProteinID: NP_524071
FlyBase: FBgn0041604
UniProt: Q9VUG1
Structure
PDB: 
3ODN

Position
3L
AA seq 765 aa
MLHQQQQQQHLHCRRKATATTTARLVIFSSPLLLLLLTTHLPPTLQADNGPAPQVAALAA
PNPAGGVAGSSIIDQFSPNCSAVTHIFQARGIDAIEIPQKPSNERVLRYCESPSVGTCCT
YNMETRMAMQSRQQLEGHTKDQISRMSGILGSKATKFKDIFTALLKESRTQFNSMFIRTY
GVIYERNSYVFSDLFKELETYFANGRVDLLEVMDKFFNTLYQKMFTVLNTQYTFDENYMR
CVSEHMKELKPFGDVPDKLSVQIKRSFVATRTYGQALTTASEVAKKVLNVRLNADCTGAL
TKMQHCGACKGYTEKPCTNYCVNVIKGCLHYQHEFDSEWENFAMAMDKVAERLLGSFNIV
MVVEPLNIKISEAIMNFQDSGQDITNRVFQGCGRPKLKKMKRSISPKLQGVQILNARSPV
EADTLDIDETLDEAIVLRERRAAEPGSQETSAQQSQEQGVGKSGNGGGGGGGNNRRQQQR
RKQQQQRRKQQNNRDDNDDDDNESGGGREPILDRIVRDIRQRVKDYKKFWSNLPHSVCSN
EDIASSSDVDGMCWNGHTIDRYMHSITTEHGSNPEFTGNPASTKQTAQMASQLSHLKNAI
VHLRNAYNGQDVEWSEQEELPYAGSGAGSGSGSEDDEDDDEGSGLGPFEPSHKPDVERPS
VDADNDDDEDAGGRGHMPTHTSRPTSGVDDKNPLIHTTHFDQDHNDLDEDHRQLDEDEDT
DAGHDGANDNRSSDAPEKMTLRRALVVYLLPLYMAWFGGVCADLL
NT seq 2298 nt   +upstreamnt  +downstreamnt
atgctacatcagcagcaacaacaacaacatctgcattgcagaagaaaagctacagcaaca
acaactgcccgccttgtgatattcagcagtcctcttctactattactactcaccacccac
ttgccgcccaccttacaagcggacaatggccccgccccccaagtggccgcccttgccgcc
cccaatccggcgggtggcgtagcagggtcttcgatcatcgatcaattcagtccgaattgc
agtgctgtgacacacattttccaagcgagaggaatcgatgccatcgaaattccccaaaaa
cccagtaacgaacgagtcctacgatattgcgagtccccttcggtgggcacttgttgcacc
tacaacatggagacccgcatggcgatgcaatcccgccagcagctcgaagggcacaccaag
gaccagatctctcgtatgtctggaatcctgggcagcaaggccacaaaattcaaagatatt
ttcacggccctgctcaaagagtcgcgaacgcagttcaatagtatgttcatccgaacatac
ggcgtcatttacgagagaaattcgtacgtcttctcggatctgttcaaggagttggaaacc
tacttcgccaacggtcgcgtggacttgctggaggtcatggacaagttcttcaatacgcta
taccagaagatgttcaccgtgctgaacacccagtacacatttgatgaaaactacatgcga
tgcgtcagcgagcacatgaaggagctgaagcctttcggagatgttccggacaagctgtcc
gtgcaaatcaagcgatcctttgtggccacgcgcacctatggccaggctctgaccaccgct
tcggaggtggcgaagaaggtcctcaatgtgcgactgaatgccgattgtactggggctctt
accaagatgcagcactgtggtgcttgcaagggatatacggaaaagccctgtaccaactac
tgtgtgaacgtcatcaagggatgcctgcactatcagcacgagttcgacagcgaatgggag
aactttgcgatggccatggacaaggtggcggaacgactgctgggatccttcaacattgtg
atggtggtggagccactcaacatcaagatctccgaggccatcatgaacttccaggattct
ggccaggacatcaccaaccgcgtattccaaggatgcggtaggccaaagttgaagaaaatg
aaacggtccatcagccccaaactgcaaggagttcaaatcctcaacgcaaggagtcctgtg
gaggccgatactctggacattgatgaaacgttggacgaggcgattgtgctgagagaacgc
agagctgctgagcccggctcacaggagacatcggcgcaacagtctcaagagcaaggagtt
ggaaagagtggaaatggaggaggaggcggtggcggtaacaacaggcggcaacagcaacgt
cgaaagcagcagcaacagcgacgcaaacagcaaaacaatcgcgacgacaacgatgacgat
gacaatgagagcggaggtggacgtgaaccgattctggacaggatcgtgagggacattcgc
cagcgagtgaaggactacaaaaagttctggtccaatctgccgcactcggtttgtagcaac
gaggatatagcctccagttccgatgtggacggcatgtgctggaatggtcacacaattgat
agatacatgcactcaatcaccacagaacacggctcgaatccggagtttacaggcaatcct
gccagtactaagcaaacagctcaaatggcctctcaactaagtcatctgaagaatgccatt
gtccaccttcgaaatgcctacaacggccaggatgttgagtggagcgaacaagaagaactg
ccatatgcgggtagtggagctggttctggatccgggtccgaagacgacgaggacgatgac
gagggctctggcctgggacccttcgaacccagccataagccggacgtggagcgtccttcg
gtggatgcagacaacgacgatgacgaggacgccggtggacggggtcacatgcccacgcac
acatctcgaccgacgagcggagtggacgacaagaatccgctcatccacaccactcacttc
gaccaagatcacaacgatctggatgaggatcataggcagctggatgaggatgaggacacg
gatgcaggccatgacggggccaatgacaatcgatcatccgatgccccagaaaagatgacg
ctgcgtcgcgctctggttgtttatctgctgcccctttatatggcgtggttcggtggcgtc
tgcgccgatttgctgtga

DBGET integrated database retrieval system