KEGG   Drosophila melanogaster (fruit fly): Dmel_CG32276
Entry
Dmel_CG32276      CDS       T00030                                 

Gene name
CG32276
Definition
(RefSeq) uncharacterized protein, isoform A
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: RAMP4 DUF1206
Other DBs
NCBI-GeneID: 251645
NCBI-ProteinID: NP_728830
FlyBase: FBgn0047135
UniProt: Q8SYY6
Position
3L
AA seq 64 aa
MAPPQRMRVANEKASKYVTMRGNVPKSSKTKEGQYPVGPWLLALFIFVVCGSAIFQIVQS
IRAA
NT seq 195 nt   +upstreamnt  +downstreamnt
atggctccaccacagagaatgcgcgtcgctaacgagaaggccagcaaatatgtgacaatg
cgtggcaatgtacccaaatcctcgaaaacgaaagagggtcaatatccggtgggtccctgg
ctcctggcgctgttcatctttgtggtctgcggctctgccattttccagattgttcagtcg
atacgcgccgcgtaa

DBGET integrated database retrieval system