KEGG   Drosophila melanogaster (fruit fly): Dmel_CG32300Help
Entry
Dmel_CG32300      CDS       T00030                                 

Gene name
oxt
Definition
(RefSeq) peptide O-xylosyltransferase
  KO
K00771  protein xylosyltransferase [EC:2.4.2.26]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00532  Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
dme00534  Glycosaminoglycan biosynthesis - heparan sulfate / heparin
dme01100  Metabolic pathways
Module
dme_M00057  Glycosaminoglycan biosynthesis, linkage tetrasaccharide
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00532 Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
    Dmel_CG32300 (oxt)
   00534 Glycosaminoglycan biosynthesis - heparan sulfate / heparin
    Dmel_CG32300 (oxt)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dme01003]
    Dmel_CG32300 (oxt)
Enzymes [BR:dme01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.26  protein xylosyltransferase
     Dmel_CG32300 (oxt)
Glycosyltransferases [BR:dme01003]
 O-Glycan biosynthesis
  Glycosaminoglycan
   Dmel_CG32300 (oxt)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Xylo_C Branch WSC
Motif
Other DBs
NCBI-GeneID: 38288
NCBI-ProteinID: NP_647705
FlyBase: FBgn0015360
UniProt: Q7KVA1
Position
3L
AA seq 876 aa AA seqDB search
MEQSVSARWLKRYRAFFLILLLIVAIQLFLAYKSLDIVGGGSGSGFDAAEAPASPPPPHA
QARVQPPARTKLTAQQLGFQPECDILAREAISALQRAKTKDCREHIAQIACAIQAGRFYA
PQLRSSCPAGNHTANVSLGCFKDEKDRRLLAGYYSSSKTSNSPAKCVELCLQSGYPYAGV
QYGRECFCGYDPPPKASKLPDSSCNTKCLGNAKEICGGFYAMNIYETGIAKFTAQLAATT
PSEETKRVRIAFLLTLNGRALRQVHRLLKALYAPEHVYYIHVDERQDYLYRKLLELESKF
PNIRLARKRFSTIWGGASLLTMLLQCMEDLLQSNWHWDFVINLSESDFPVKTLDKLVDFL
SANPGRNFVKGHGRETQKFIQKQGLDKTFVECDTHMWRIGDRKLPAGIQVDGGSDWVALS
RPFVGYVTHPREDDELLQALLKLFRHTLLPAESFFHTVLRNTKHCTSYVDNNLHVTNWKR
KQGCKCQYKHVVDWCGCSPNDFKPEDWPRLQATEQKSLFFARKFEPVINQAVLLQLEEWL
YGPYTSEYANLHGYWQSLYHHEDVHGSGDDLARSIGDSVMRLSARQAKLYPLELIELTHY
LHRDQYKGFLVRYRARGSTGKPLHLETRVRPTQQGKLARNARFSKRLRNFEVSTDFDQKE
QIARNFGKLLGPQSDLLLSYTLQANADSGAASHSYNLTLLWIDPLGRLQDFNELHVEDST
SDVINHSKTLLKHPITPGIWTAKLIGRNSIYAQLKFLIAPLAYYKGYPLAKSSDAEALNA
GLTVALPEDFEMPVEWQQHLQTDDEQFTMREESLAKGKMLGQELHSWIDGLVGQFFQLRE
SCVVEADSEVSLPLCSDAPWSSLAPDPKSDVDALLK
NT seq 2631 nt NT seq  +upstreamnt  +downstreamnt
atggagcagtctgtgtccgcccgctggctgaagcgctatcgcgcattcttcctcatcctg
ctgcttatcgtggccatccagttgttcctggcctacaagtccctggacatcgtaggcggc
ggttccggttccggatttgatgcggctgaagcgcctgccagtcctccgcctccgcatgct
caggcacgggtccaaccgcccgccaggaccaagcttactgcccagcaactgggcttccag
ccagagtgcgacattctcgccagagaggccatctccgccctgcagcgcgccaaaacgaaa
gactgtcgagaacatatcgcgcagatcgcctgcgcaatccaagccggacgcttctatgcg
ccgcagctccggagcagctgtccagctggtaatcacacggcgaacgtttctttgggatgc
ttcaaggatgagaaagatcgccgccttctggccggctactacagcagctccaagacctcc
aattctccggccaaatgcgtggagctatgtctgcaaagcggttacccgtacgcaggggtg
cagtacggtcgcgagtgcttctgcggttacgacccgcctcctaaagcgtcgaagctgccg
gactccagttgcaacaccaagtgcctgggcaacgccaaggaaatctgcggcggattctat
gccatgaacatatacgagaccggaatagccaagttcaccgctcaactggcggccaccact
ccttcggaggaaacgaagcgcgtgcggatcgcatttctgctgacgctcaacggaagagcg
ctgcgtcaggtgcaccgacttctgaaggcgctctatgcaccggagcacgtttactacatc
catgtggacgagcgccaagattacctgtaccgaaagctgctggagttggagtcaaagttc
cccaacatacgtttggctcggaagcgattctccaccatatggggtggagcctctctcctg
accatgctgctccagtgcatggaggacctactgcagtccaactggcactgggactttgtg
atcaaccttagcgaaagtgattttccagtgaagaccctcgacaagttggtggatttcttg
agcgccaatcctggcaggaactttgttaagggccacggccgggagacacagaagttcatc
cagaagcagggcttggacaagacgttcgtcgagtgcgacacgcacatgtggagaatagga
gatcggaagttgccagctggcattcaagtggacggaggcagtgactgggtggcgctatca
cgaccttttgtgggctatgttactcatcccagggaagacgatgagttgttgcaggctctt
ctaaagctcttccgacacacgctcctgccggcggaatcgtttttccacacggtcctcagg
aataccaagcattgcacgagctatgtggacaacaacctgcacgtcaccaactggaagcgg
aagcagggttgcaaatgccagtacaagcatgtggtggattggtgcggatgcagtccaaac
gactttaagccagaagattggcccaggctgcaggccacggagcagaaatcactgttcttc
gcccgcaagtttgagcccgttatcaaccaggcggtgctgctccagctggaggagtggctc
tacgggccatacaccagcgaatacgccaatctgcacggctactggcagtcgctgtatcac
cacgaggatgtccatggatcaggagacgacttggccagaagcattggagatagcgtaatg
cgtctgtctgcgcgtcaagcgaaattgtatcccctggagttgattgaactcactcactac
ctccaccgggaccagtacaaggggttcctggtgcgctacagagccagaggatctactgga
aagccgctgcacttggagacgagagtgcgaccgacgcagcaaggaaagctggcgaggaat
gctcgcttcagcaagcgattacgcaactttgaggtctctacagatttcgatcaaaaggag
cagattgcccgcaactttggaaagctcttgggtccccaaagtgacttgcttttgagctac
acactccaagcaaacgcagattcgggcgccgcttcccattcgtacaacctcaccctgctg
tggatagatccgctgggccgattgcaagattttaatgaattgcatgttgaggattccacc
agcgatgtgataaaccactcgaaaaccctgctcaaacacccgatcacaccgggcatctgg
acagccaagttaataggccgcaattcgatctatgcgcagttgaaattcctaatagctcca
ctggcctactacaagggctatccgctagcaaagtcctcagatgctgaggcgctaaacgcc
ggcttgactgtagctctgcctgaagattttgagatgcccgtggagtggcagcagcacctt
caaaccgacgacgagcagttcaccatgcgcgaggagtccctggccaaagggaaaatgctg
ggacaggagctgcacagctggattgacggattggtgggccaattctttcaactgcgtgag
agctgcgtggtggaggcggacagcgaggtttccctgccgctgtgcagcgatgcgccctgg
agctcactggcacccgaccccaagagcgatgtggatgccctgctcaaatga

DBGET integrated database retrieval system