KEGG   Drosophila melanogaster (fruit fly): Dmel_CG32372
Entry
Dmel_CG32372      CDS       T00030                                 

Gene name
ltl
Definition
(RefSeq) larval translucida, isoform B
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_5 LRR_9 FNIP Dicty_REP LRR_1
Other DBs
NCBI-GeneID: 38845
NCBI-ProteinID: NP_001261524
FlyBase: FBgn0268063
UniProt: Q9VS84
Position
3L
AA seq 817 aa
MTSLVYTVFHLASLQCSVRPEISPCTCETGKAWNHVELSCEKLESFNAVVDSLANKLNAD
TNIDLKITHSQLDDLEMRSFTDMNFNLYKLRMQWNSLKSLPEVPFRGLSNVTYLSIGDND
LDEIPKHALSHMPSLLTLDIGRCKIRAVQQEDFRGIQRVTNLILVSNIITRLDRGSFPKS
LLILHLGRNQLESLNGSLHDLHNLESLFINANNITSLDDELPDGGQLRLLMAHNNRLERL
PANMAGMHSLETVHIHCNQLRSFDRVLRNAVNLSEVMADNNELEYLAQDEFASCSKVETL
QMGCNHIKSLNSSLLPILKLKNANFSFNDIEEFSMAELHGLRSLKTLQLSSNRIQRLLPD
PRGVQELMLVNLDLDNNRIDSLNGALAGLGNLRILNLAGNRLEHLQVGDFDGMIRLDILD
LTGNQLAELKPLEMTLLPSLKILKVAYNNITKLEQDFKGLPVLCQANLTNNQISTISSEL
VTNTRCKNHNVPGKLEIHLDDNPIMCDVGLNELCRLMAVQEARIRGRSQCFENDQEVCTV
LPMLYNVNLPIMVTNLKLTGREVPKPMVRVIVPSLIKANNELLPPLIATLGNPVLISTDL
VNPVISPLPPPLLLATTTPPPPLPLPVESEVEKNESTTANPVPTNYTQETTTTTSTTTTT
TTTETSSQVAPIEIITTTAPTTTTTSTTTPKPNETLPVIVELQDPNPPDTTVNQTALVPP
VVLDPLQQDLERERERERERELERDLDHEAVAKTEYETVEYIPNLVQPPVGSDALTPPPS
KANALEEDSESVHSNSVHAEYPHAAQSLQIPEEPPEE
NT seq 2454 nt   +upstreamnt  +downstreamnt
atgacttccctcgtgtacaccgtctttcacctggcctcgctgcaatgttccgtgcgtccg
gagatctcgccctgcacctgcgaaacgggcaaagcctggaatcatgtggagctctcctgc
gagaagttggaatccttcaacgccgtcgtggacagcctggccaataagctcaatgccgac
accaatatcgacctaaagatcacgcactcgcaactcgacgacctggaaatgcgctcgttt
acggatatgaacttcaacttgtacaagctacggatgcagtggaacagtctaaaatcgctg
cccgaggtgccgttccgcgggttatcgaatgtcacctacctaagcatcggcgacaacgac
ctcgacgagatcccgaagcacgccctgagccacatgccgagccttttgactctggacatt
gggcggtgcaagatacgggcggtgcagcaggaggacttccggggcatacagcgggtaacg
aatctgattctggtgagcaacatcattacgcgcctggaccgaggatcctttcccaagagc
ctcctcatcctgcatctgggtagaaaccaactggagtcgctgaatggctcgcttcacgat
ctgcacaacttggagtctctgttcatcaatgcgaataatatcacatcgctggatgatgag
ctacccgatggagggcagttgcgcctcctgatggctcacaataataggttggaacgcctg
ccggccaatatggccggtatgcacagcctggagacggtccacatacactgcaaccagctg
agatccttcgaccgtgtacttcgcaatgccgtcaatctgtccgaggtcatggccgataac
aatgagctggagtacctggcccaggatgaattcgcctcctgctccaaggtggagaccctg
cagatgggctgcaatcacatcaagtcgctcaactcctcgctactgcccatcctcaagctg
aagaatgccaacttctcgttcaacgacatcgaagagttctccatggcggaactgcacgga
ttgcgatcgctgaagacactccagctgtccagtaatcgcatccaacgactgctgcccgat
ccccggggagtgcaggagctgatgcttgtcaatctggatctggataacaatagaatcgac
tctctgaatggagctttggctggcttgggcaatcttcggatactcaatttggctggaaac
cgattggaacatctccaggtgggcgatttcgatggcatgattcgattggacatcctcgac
ctgaccgggaatcagctagcggagctcaagcccttggaaatgactttgttgcccagcctg
aaaatccttaaggttgcgtacaacaatatcaccaagctggaacaggacttcaagggactg
cccgtgctttgccaggccaacttgaccaataaccagatttcgaccatatcgagtgaactc
gtcaccaacacgcgctgcaaaaatcacaatgttcccggcaaactggagatacatctagat
gacaatcccataatgtgtgacgtgggattgaacgagctgtgtcgattgatggccgttcag
gaggcacgaattcgtggtcgatcccagtgctttgagaatgaccaggaggtgtgcaccgtg
ctcccgatgctatacaatgtgaacctgcccataatggtgaccaatctaaagttgacgggc
cgcgaggttccaaagccgatggttcgggtgatcgtaccatcgctgatcaaggccaataat
gagctattaccgccacttattgccactctgggtaatccagtgctcattagcaccgatttg
gtcaatccggtgatatcgccactaccaccaccacttctgctggccaccacaacgccgcca
ccgcctctgccacttcctgtggaatcggaagttgagaagaatgagtctaccactgcgaat
ccagtgccaaccaattacacacaggagaccacgacaaccacaagtaccacaacgacgaca
acaacaacggagaccagtagtcaggtggctcccatcgagattattacgactacagcaccc
acgacgactaccaccagcaccacaacaccgaaacccaatgaaacgctgcccgtgattgtg
gaactccaggatcccaatccaccggacactacagtcaatcaaactgccctcgttccgcca
gtggttctagatcccctgcagcaggatctggaaagggagagggaacgcgaaagggagcga
gaactagagcgggatctggaccacgaggcggtggccaagaccgagtacgagacggtcgag
tacatccccaatctggtgcagcctccagtgggcagtgatgcactgacgccgcctccgagc
aaggcgaatgcgctggaggaggactccgagtcggtgcactctaactcagtgcacgcggag
tatccccacgcggcgcagagcctccagattcccgaggaaccgccggaggagtga

DBGET integrated database retrieval system