KEGG   Drosophila melanogaster (fruit fly): Dmel_CG32744
Entry
Dmel_CG32744      CDS       T00030                                 

Gene name
Ubi-p5E
Definition
(RefSeq) Ubiquitin-5E, isoform B
  KO
K08770  ubiquitin C
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04120  Ubiquitin mediated proteolysis
dme04137  Mitophagy - animal
Brite
KEGG Orthology (KO) [BR:dme00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    Dmel_CG32744 (Ubi-p5E)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    Dmel_CG32744 (Ubi-p5E)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dme04121]
    Dmel_CG32744 (Ubi-p5E)
Ubiquitin system [BR:dme04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   Dmel_CG32744 (Ubi-p5E)
SSDB
Motif
Pfam: ubiquitin Rad60-SLD Ubiquitin_2 TBK1_ULD Rad60-SLD_2 Ubiquitin_5
Other DBs
NCBI-GeneID: 326237
NCBI-ProteinID: NP_001284937
FlyBase: FBgn0086558
UniProt: Q9W418
Position
X
AA seq 534 aa
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
ITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR
LRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL
SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQ
QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIE
NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAI
NT seq 1605 nt   +upstreamnt  +downstreamnt
atgcaaattttcgttaagaccctcactggcaagaccatcactttggaggttgagccatcc
gataccattgagaacgttaaggccaagatccaggacaaggagggaatccccccagatcag
cagcgtttgatcttcgccggaaagcagctggaggacggacgcactctgtccgactacaac
atccagaaggagtcgacccttcacttggtcctgcgtctgcgtggtggcatgcagatcttt
gtgaagaccctcactggcaagaccatcactttggaggtcgagccatccgataccattgag
aacgttaaggcaaagatccaggacaaggagggaatccccccagatcagcagcgtttgatc
ttcgccggaaagcagctggaggacggacgcactctgtccgactacaacatccagaaggag
tcgacccttcacttggtcctgcgtctgcgtggtggcatgcagatctttgttaagaccctc
actggcaagaccatcaccttggaggtcgagccatccgataccattgagaacgttaaggcc
aagatccaggacaaggagggaatccccccagatcagcagcgtttgattttcgccggaaag
cagctggaggacggacgcactctgtccgactacaacatccagaaggagtcgacccttcac
ttggtcttgcgtctgcgtggtggcatgcagatcttcgttaagaccctcactggcaagacc
atcaccttggaggtcgagccatccgataccattgagaacgttaaggccaagatccaggac
aaggagggaatccccccagatcagcagcgtttgattttcgccggaaagcagctggaggac
ggacgcactttgtccgactacaacatccagaaggagtcgacccttcacttggtcttgcgt
ctgcgtggtggcatgcagatcttcgttaagaccctcactggcaagaccatcaccttggag
gtcgagccatccgataccattgagaacgttaaggccaagatccaggacaaggagggaatc
cccccagatcagcagcgtttgattttcgccggaaagcagctggaggacggacgtactctg
tccgactacaacatccagaaggagtcgactcttcacttggtcctgcgtctgcgtggtggc
atgcagatcttcgttaagaccctcactggcaagaccatcactttggaggtcgagccatcc
gataccattgagaacgttaaggccaagatccaggacaaggagggaatccccccagatcag
cagcgtttgattttcgccggaaagcagctggaggacggacgcactctgtccgactacaac
atccagaaggagtcgacccttcacttggtcttgcgtctgcgtggtggcatgcagatcttc
gttaagaccctcactggcaagaccatcaccttggaggtcgagccatccgataccattgag
aacgttaaggccaagatccaggacaaggagggaatccccccagatcagcagcgtttgatt
ttcgccggaaagcagctcgaggacggacgcactctgtccgactacaacatccagaaggag
tcgacccttcacttggtcctgcgtctgcgtggtggcgccatctag

DBGET integrated database retrieval system