KEGG   Drosophila melanogaster (fruit fly): Dmel_CG32812Help
Entry
Dmel_CG32812      CDS       T00030                                 

Gene name
CG32812
Definition
(RefSeq) uncharacterized protein, isoform B
  KO
K17610  calcineurin B homologous protein 1
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Protein phosphatases and associated proteins [BR:dme01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     Dmel_CG32812 (CG32812)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_8 RST
Motif
Other DBs
NCBI-GeneID: 31074
NCBI-ProteinID: NP_001284770
FlyBase: FBgn0025642
UniProt: O77424
Position
X
AA seq 225 aa AA seqDB search
MGSVGSRQLNPVQLCDHQQATGLSAEQLEQLHTRFRSLDRHQRGYLTPTDLLRIPQLSLN
PLHRQIIDGFFPSRDPSARIGFKQFVDTCSTILVPQFGRGSVRRRDGRVQKLQLLSKMFD
TRRSGCITRSDFRQIMRSIVNLAWSQQQDQERQEGLSENRLPEVEAELQLLEHQAFGFCC
DHISYGEFEKRLFSVDVDRRLSIAKWLEDDDEADAEMVLPVGSGP
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgggctcggtaggaagtcgtcagctcaaccccgtccaactgtgtgaccaccagcaggcc
acagggctgtccgcagagcagctagagcagctgcacacgcggttccgcagcctggatcgc
caccagcgcggctatttgacgcccaccgacttgctgcgcattccgcagctatccctcaac
ccgcttcaccgccagatcatcgacggcttcttccccagccgtgaccccagcgcgcgtatc
ggtttcaagcagttcgtggacacttgctccaccattttggtgccacagtttggacgcggt
tcagtgaggcggcgcgacgggcgtgttcagaagcttcaactcctgtccaagatgtttgac
acgaggcgcagcggctgcatcacacgctccgacttccgccagatcatgcgcagcattgtc
aatctggcctggagtcagcaacaggatcaggaacgtcaggaggggctttccgagaaccgt
ttgcctgaggtggaggccgagttgcaacttttagagcatcaggcctttggcttctgctgc
gaccatatctcatatggggagttcgagaagcgcctgtttagtgtggacgtcgacagacgg
ctgtcgatcgccaagtggctggaggacgatgacgaggccgatgccgagatggtactgcca
gttggctcaggcccgtaa

DBGET integrated database retrieval system