KEGG   Drosophila melanogaster (fruit fly): Dmel_CG32843
Entry
Dmel_CG32843      CDS       T00030                                 
Symbol
Dh31-R
Name
(RefSeq) diuretic hormone 31 receptor, isoform B
  KO
K04577  calcitonin receptor-like
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    Dmel_CG32843 (Dh31-R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:dme04030]
    Dmel_CG32843 (Dh31-R)
G protein-coupled receptors [BR:dme04030]
 Secretin receptor family
  Calcium-regulating peptide
   Calcitonin
    Dmel_CG32843 (Dh31-R)
SSDB
Motif
Pfam: 7tm_2 HRM
Other DBs
NCBI-GeneID: 36475
NCBI-ProteinID: NP_001260950
FlyBase: FBgn0052843
UniProt: A0A0B4KEN5
Position
2R
AA seq 431 aa
MSDQIGNPNATFSGSGSGSGTNVASIAESVAESGPDFDALRAACETRLNASGQLAGSGGP
GAEAGTHCAGTFDGWLCWPDTAVGTSAYELCPDFITGFDPARYAHKECGLDGEWFKHPLT
NKTWSNYTTCVNLEDLNWRHTVNLISEVGYGTSLLAILLSLAILGYFKSLKCARITLHMN
LFASFAANNSLWLVWYLLVMPNSELLHQSPMRCVALHITLHYFLLSNYSWMLCEGFYLHT
VLVAAFISEKRLVKWLIAFGWGSPAIVIFVYSMARGLGGTPEDNRHCWMNQTNYQNILMV
PVCISMFLNLLFLCNIVRVVLLKLNAPASIQGSCGPSRTVLQAFRATLLLVPLLGLQYIL
TPFRPAPKHPWENTYEIISAFTASFQGLCVAILFCFCNGEVIAQMKRKWRMMCFSNRPRT
NSYTATQVSFF
NT seq 1296 nt   +upstreamnt  +downstreamnt
atgagcgaccagattggcaaccccaatgcaacattcagtggcagtggcagtggcagtggc
accaacgtcgcctccatcgccgaaagtgtggcggagagcggaccggacttcgatgcactt
cgggccgcctgcgaaacgcggctaaatgccagcggtcaactggcgggctccggaggacca
ggcgcagaagcaggaacccactgtgccggcacctttgatggctggctttgttggccggat
acggctgtcggcacttccgcctacgaactctgcccggacttcatcacgggattcgatcca
gcaagatatgcccacaaggaatgcggtctcgatggcgagtggttcaagcatccgctgacc
aataaaacatggtccaactacacaacctgcgtaaatctcgaagacctcaactggaggcac
acagtgaatctgatctccgaggttggctacggcacctcactgctggccattctgctgtcg
ttggccatattgggttatttcaaatccctgaagtgcgcccgcatcacgctgcacatgaat
ctgttcgcctcgttcgctgccaataactcgttgtggctggtctggtacctgctggtcatg
ccgaattcggagctactgcatcagagtccgatgcgctgcgttgccctgcacataacgcta
cactacttcctcctgtccaattactcctggatgctctgcgagggattctatctgcacacc
gtcctcgtcgccgcattcatttccgagaagaggctggtcaaatggctcatcgcattcggc
tggggctccccggccatcgtcatattcgtctatagcatggctcgcggtctgggcggcacg
cccgaggacaatcgtcactgctggatgaaccaaaccaactaccaaaacattcttatggtg
cctgtgtgtatctccatgttcctgaacctcctgttcctgtgcaacattgtgcgagtggtc
cttttgaaactgaatgccccggccagtattcagggcagctgcggtccatcgcgaacggtt
ttgcaagcatttcgggcaacgctgcttttggttcctctgctcggcctccagtacatcctt
acgccctttcgtcctgcacccaaacatccctgggagaatacatacgaaatcatctcggcg
tttacggcctcatttcaaggtctgtgcgttgccattttgttctgcttttgcaacggcgag
gtgattgcccaaatgaagcgcaagtggcggatgatgtgcttcagcaaccgaccgcggacc
aattcctatacagccactcaggtctcgttcttttga

DBGET integrated database retrieval system