KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3320
Entry
Dmel_CG3320       CDS       T00030                                 

Symbol
Rab1
Name
(RefSeq) Rab1
  KO
K07874  Ras-related protein Rab-1A
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:dme00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    Dmel_CG3320 (Rab1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dme04131]
    Dmel_CG3320 (Rab1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dme04147]
    Dmel_CG3320 (Rab1)
   04031 GTP-binding proteins [BR:dme04031]
    Dmel_CG3320 (Rab1)
Membrane trafficking [BR:dme04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab GTPases
    Dmel_CG3320 (Rab1)
 Autophagy
  Other autophagy associated proteins
    Dmel_CG3320 (Rab1)
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dmel_CG3320 (Rab1)
  Exosomal proteins of other body fluids (saliva and urine)
   Dmel_CG3320 (Rab1)
  Exosomal proteins of colorectal cancer cells
   Dmel_CG3320 (Rab1)
GTP-binding proteins [BR:dme04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab1/35 [OT]
    Dmel_CG3320 (Rab1)
SSDB
Motif
Pfam: Ras Roc Arf SRPRB RsgA_GTPase GTP_EFTU MMR_HSR1 Gtr1_RagA AAA_5 AAA FeoB_N AAA_22 PduV-EutP AAA_16 AAA_29 AAA_7 Septin ABC_tran TniB
Other DBs
NCBI-GeneID: 42524
NCBI-ProteinID: NP_732610
FlyBase: FBgn0285937
UniProt: O18332
Position
3R
AA seq 205 aa
MSSVNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTI
KLQIWDTAGQERFRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKL
LVGNKSDLTTKKVVDHTTAAEYAAQLGIPFLETSAKSATNVEQAFMTMAAEIKNRVGPPS
SATDNASKVKIDQGRPVENTKSGCC
NT seq 618 nt   +upstreamnt  +downstreamnt
atgtcatctgtgaatccggaatacgattatctctttaagttgctgcttattggagactcg
ggcgttggaaagtcctgtcttctgttgcgatttgccgatgacacatatacagaaagttat
atcagcacaatcggagtggatttcaaaatcaggactatagaactcgacggaaagaccatt
aaactgcaaatctgggatactgctggccaggagcgcttccgcaccatcacgtcttcatat
tataggggcgcccatggcatcattgtcgtatacgattgcacggaccaggagtctttcaac
aatgtgaagcagtggctggaggagatcgagcggtatgcctgtgagaatgtcaacaagttg
ctggttggcaacaagagcgacttgaccaccaagaaagtagtcgaccacaccacagctgcg
gagtacgccgcccagttaggcattccattccttgaaacttcggccaagagcgccaccaac
gttgagcaggccttcatgacgatggcggcggagatcaagaatcgcgtcgggccgccgtcc
agcgccactgacaacgctagcaaagtgaaaatcgatcaaggacgtccagtggaaaacacc
aaatccggttgctgctga

DBGET integrated database retrieval system