KEGG   Drosophila melanogaster (fruit fly): Dmel_CG33337
Entry
Dmel_CG33337      CDS       T00030                                 

Symbol
CG33337
Name
(RefSeq) uncharacterized protein
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: NRF Acyl_transf_3 OppC_N YdiH
Other DBs
NCBI-GeneID: 2768678
NCBI-ProteinID: NP_996269
FlyBase: FBgn0053337
UniProt: Q7KS40
Position
3R:complement(23590141..23592769)
AA seq 708 aa
MVKILSFILLSGLVLIGAIQSEDRSVLEEYQRLRKLKPLGIEFADYFQNVTLNDLSLFDS
RLPTQADLLCLNDLTKLVSALQGGQYWAFKMIDAWGGIPSGIFTGNVYDLGNFDECINIK
KDSIRGKYCFLDVSPAKILGVESSLAGILKIKTATCFPASCSATHMNKFVDTILKRILNV
SIPSTAMSISDDSCQTAESEPWSGLTILTIVILSLMGVIVAIATLYDYFLVKSQDQLHTA
VKLFSARANSCALFRIVVNQSNPNVIECLHGIRCMSLFWVVWIHQYDNVFSAPNINRFRF
LSWLQTPFTMFFLEGNFSVDSFFFIGGFLVSLNALGTMEKNNGKINVPRMYIRRFIRIFP
ILAMSILVYTQLTGVLGDGPLFKGGYSKKASCAKTWYMTLLFVVNFANDMCLDHTWYLAV
DMQLFLISPILLFALYKWGKKAAAAIGVLIVLLSGCLFATMMVNHYSIKSLDFSLQKKTY
FYTHTHAAPWLIGFLYGYFVFLNKGRKFKMNWIAVWSGWILCLAMLFTSIFALYPKLESG
KPWLMTTLEVSSYYTLTRVGWPMAVGWVVFACMQGYGGMANTFLSSPLWQPISKLSYSIY
IWHSFIQEINKRIVRTNTYFSNYQVMLNFWSTMGFTVLFSYLLYLLIEAPIGGLDRLLRP
KKKAPAENKPMTNSDRVGEGHGHDVDLSNQRELEGNDSSADQLAEKSQ
NT seq 2127 nt   +upstreamnt  +downstreamnt
atggttaaaattctcagttttattttgcttagtgggctggtgctcatcggtgccatacag
tctgaggacagaagtgtcctggaagaataccagcgcctgaggaagctcaaaccgttgggt
attgagtttgccgattactttcaaaatgtaacgctaaatgatttgagcctgtttgactcg
cgattgcccacacaggcggatcttctgtgcttaaatgacttaactaagcttgtctcggct
cttcaaggtggacaatattgggcattcaaaatgattgacgcatggggaggcataccatct
ggtattttcaccggtaacgtgtatgacttgggaaatttcgacgagtgcatcaatatcaag
aaggacagcatacgtggaaaatactgctttttagacgtttcacccgcgaaaatattggga
gttgagagttcattagccggaatattgaaaattaagacggctacatgctttccggcttcc
tgttcggccactcacatgaacaagtttgtggatacgattttaaaaaggatactgaatgtg
agtatacccagtacagccatgagtatcagcgatgattcttgccaaacagctgaaagcgag
ccctggagtggactaacgattttaacaatagtcatactgtcactgatgggcgtaatcgtg
gctatagctacgttgtacgattactttttggtcaagagtcaggatcaacttcacacggct
gtcaagttgttttcagccagggccaactcttgtgcacttttccgcattgtggtaaatcaa
tcgaacccgaatgtaattgaatgccttcacggaattcggtgcatgtcccttttctgggtg
gtttggattcatcagtatgataatgtgttttctgcgccaaacattaatcgatttagattt
ctttcgtggcttcaaacgcctttcacaatgttttttctggagggaaatttttcagtcgat
tcatttttctttatcggaggtttcttggtttcattaaatgcactgggaacaatggaaaaa
aacaatggcaaaattaatgttccaagaatgtatatacgccgtttcatccgcatttttcct
attctggctatgtctattctggtctacacacaacttacaggtgttttgggggatgggcca
cttttcaagggcggatatagtaagaaagcatcatgtgcaaaaacttggtacatgaccttg
cttttcgttgttaacttcgcaaatgatatgtgcctagatcatacctggtatttggcggtg
gacatgcagcttttcctcatatctcctatcctgctatttgctctttataaatggggcaag
aaggctgctgctgctatcggcgttctaatagttttgctatctggatgcctgtttgccacc
atgatggtcaaccactattctataaagagtcttgacttttccttgcaaaagaaaacgtat
ttctacacccatactcacgctgctccgtggctcattggattcttgtatggctactttgtg
ttcttgaataagggaagaaagtttaaaatgaactggatagcggtctggtcgggatggatt
ctttgcctggctatgctctttacctcgatcttcgcactctatccgaaacttgagtcggga
aagccttggctaatgaccaccctcgaagtgtcatcttattacacccttacccgtgtgggc
tggcccatggcagttggttgggtggtctttgcctgtatgcaaggatacggcgggatggcc
aatacttttctctcctctccgctgtggcaacctatttccaaattatcatattccatctat
atatggcacagtttcatccaggaaataaacaaacgaattgttagaacaaatacgtacttt
tcgaattatcaagtgatgcttaatttctggtcaaccatgggattcactgtgcttttttcc
tatctcctgtacttgctaattgaggcgcctattggtggacttgaccgccttttacgccca
aaaaagaaagcaccagcagagaataagccgatgacgaactcagaccgagtgggcgaaggc
catggacatgatgttgacttaagcaaccaaagagaactggaaggtaatgactcaagtgct
gaccaactcgctgaaaagtctcaataa

DBGET integrated database retrieval system