KEGG   Drosophila melanogaster (fruit fly): Dmel_CG33458
Entry
Dmel_CG33458      CDS       T00030                                 

Gene name
CG33458
Definition
(RefSeq) uncharacterized protein
Organism
dme  Drosophila melanogaster (fruit fly)
Motif
Pfam: Trypsin DUF1986
Other DBs
NCBI-GeneID: 2768846
NCBI-ProteinID: NP_995854
FlyBase: FBgn0053458
UniProt: A1ZAG8
Position
2R
AA seq 281 aa
MKLIPALLALLILGHGISLGYSYLLEWDCGISKYTYRITGGRDSPLMLNPWLAYLHINSK
FICGGSLLNHWFVLTAAHCFRDKNAKVLVRLGENDASQKIDCNESECAAPHLEYMIMQKL
IHPLYRTAHYYDIALAKLNRYVVYTDSIRPICLMLNPNWQVYVDTIRYFIITGWGATNAS
EVSDKLQLTRIPQIDRFTCRYWFGYMVDRTHICAGESKHYVGKGDSGGPLGSMVDYKYAK
RFFQFGIVSHLRQPFHGVSVFTNILSYSNWIHRTIITNSGH
NT seq 846 nt   +upstreamnt  +downstreamnt
atgaagcttattccagctctgctagcattactgatcctgggacacggaatatctctagga
tattcgtatcttctagaatgggattgtggcatttcgaaatatacctaccggataactggc
ggtagagatagtcccctgatgctcaatccatggttagcctatttgcatattaactccaaa
ttcatttgtggtggctcgcttctcaatcattggtttgtgctgacagcagcccattgtttt
agggataagaatgctaaggttttagttcgattaggagagaacgatgctagtcagaaaatt
gattgcaatgagtctgaatgtgcggccccacatttagagtatatgattatgcaaaagttg
atccatccactatacagaacagcccactattacgatatagcgctggcaaaactcaatcga
tatgttgtatatacagatagcatacgtccgatttgcttgatgctgaatccaaactggcag
gtatatgtggacaccattagatactttattataaccggctggggtgccaccaatgcatcc
gaagtgagcgacaagctgcaactgacaagaattccccaaatcgatcgattcacctgtcgc
tactggtttggatacatggttgatcgtactcacatttgtgcgggcgaaagtaaacattat
gttggcaaaggcgattctggaggtccgctgggcagtatggtggattataagtacgccaag
cgtttctttcaattcggaatcgttagccatcttcggcaaccatttcacggtgtttctgta
ttcacgaatattttaagctactcgaattggatccatcgaaccataatcacgaatagcggg
cattga

DBGET integrated database retrieval system