KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3362Help
Entry
Dmel_CG3362       CDS       T00030                                 

Gene name
cN-IIIB
Definition
(RefSeq) cytosolic 5'-nucleotidase IIIB
  KO
K01081  5'-nucleotidase [EC:3.1.3.5]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00230  Purine metabolism
dme00240  Pyrimidine metabolism
dme00760  Nicotinate and nicotinamide metabolism
dme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Dmel_CG3362 (cN-IIIB)
   00240 Pyrimidine metabolism
    Dmel_CG3362 (cN-IIIB)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Dmel_CG3362 (cN-IIIB)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     Dmel_CG3362 (cN-IIIB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UMPH-1 HAD
Motif
Other DBs
NCBI-GeneID: 37875
NCBI-ProteinID: NP_611895
FlyBase: FBgn0034988
UniProt: Q9W197
Structure
PDB: 

Position
2R
AA seq 319 aa AA seqDB search
MGFDEKREPTGGRLRLQDIPALTQDHCRMRDPAEVERIINEFVIGGPERMQIVSDFDYTI
TKQRTEDGGAVPSSFGIFNACQSLPENFKAETDKLYHKYRPIEIDPHMPIAEKVQYMIEW
WTKSGELTSGFPFDQSEIDQIASKYTHALRDRTHEFFADLQRLGIPTLVFSAGLGNSVVS
VLRQANVLHPNVKVVSNFLQFRDGLLDGFQQPMIHTFNKNETVLNETSEYYDLVHTRDHI
IVMGDSIGDADMASGVPASSHIMKIGFLFDHVEANMKKYMDTFDIVLVDDQTMDVPRTLL
SLIEKQHKLNLEAPKQSSL
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgggctttgacgagaagcgtgagcccaccggcggcagactgcgactgcaggacattccg
gccctcacccaggaccactgccgcatgcgggatccggcggaggtggagcgcatcatcaac
gagttcgtcatcggcggaccagagcgcatgcaaatcgtctccgacttcgactacaccatc
accaagcagcgcacggaggatggaggagcagtgccctccagtttcgggatcttcaacgcc
tgccagtcgctgccggaaaactttaaggcggagacggacaagctgtaccacaagtaccgg
cccattgagatcgatccccacatgcccatcgccgagaaggtgcagtacatgatcgagtgg
tggaccaagtctggcgaactgaccagcggcttccccttcgaccagtcggaaatagatcag
atagccagcaagtacacgcatgcgctacgtgaccgcacccacgagttctttgcggacctc
cagcgcttgggcattcccacgcttgtcttctccgccgggctgggcaactcggtggtctcg
gttcttcgccaggccaacgttttgcatccgaacgtgaaggtagtctcgaactttcttcag
ttccgggatggccttctagatggctttcagcagccgatgatacacaccttcaacaagaac
gaaacggtgctaaatgagaccagcgagtattacgacttggtgcacaccagggaccacatc
atagtcatgggcgactcaattggtgatgcagacatggcctccggggtgcctgcctcctca
cacatcatgaaaatcggcttcctcttcgaccacgtagaagccaacatgaagaagtacatg
gacacctttgacatagtgctcgtcgatgaccagaccatggacgtgcccaggaccctgctc
tccctcatcgagaagcaacacaagctgaacctggaggcccccaagcagagctccctataa

DBGET integrated database retrieval system