KEGG   Drosophila melanogaster (fruit fly): Dmel_CG33670
Entry
Dmel_CG33670      CDS       T00030                                 

Gene name
stg1
Definition
(RefSeq) stargazin-like protein
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: Claudin_2 PMP22_Claudin SUR7 L_HMGIC_fpl MARVEL DUF4064 RIFIN
Other DBs
NCBI-GeneID: 318064
NCBI-ProteinID: NP_001027082
FlyBase: FBgn0064123
UniProt: Q9VRE6
Position
X
AA seq 447 aa
MRDYPSVPNVFRVASTHSINSENPYNNIRPANVICNTTERPPIAIHQLTTSASIEHSHPS
QQAQHQQQQLLHHQQQHHHQQHSPYATLPRGQRLAPQQHQQAGVINTISGSIPATGFSSL
AGSFSDLQLNNIGNHSSNSRSNHNSISNNRRQQQQQQQQQQQRLVPHLSRHQPAIEVQQT
QQHQQTQQQHVQRQQQQERLASGGAGATDPQGGISNMTTVNGGYLWLITPVAASISVAIV
IAALAGPQWLFTEEKLPNANYNGTANFKALDDGAYITKYTKSSLWILCTTLPGLDADSYN
CVKIDYFSNEGYQPDPHDSTAAIPYTVTKSCPIFLAAGVFLVISFIVFLIPTCSHQNNLY
YFSAGILFIVSGLVMLIGLIAYISILKAEIGSKLRPRSTLQPALIKVSYGQSFFLFVFGF
IVTEFVGVLNIFLFINLQEVSYYSVSN
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgagggattatccttcggtgcccaatgtgtttcgcgtggcctccacgcacagcatcaac
agcgagaatccgtacaataacattcgaccagcgaatgtaatctgcaacaccaccgaaagg
ccgccgattgccatacaccagctgaccactagtgcatccatcgagcacagccacccatcg
cagcaggcgcagcaccagcagcaacagttgctgcaccaccagcagcagcaccaccaccag
caacactcgccctatgcaacattgccgcggggccagcgactcgcgccgcagcagcatcag
caagccggtgtaatcaacacgatctctggcagcattccggccacgggatttagttccctg
gccggcagctttagtgatcttcagttgaacaacatcggtaatcacagcagcaacagcaga
agcaatcacaacagcatcagcaacaaccgacgacagcagcagcagcagcagcagcagcag
cagcagcgactggtccctcatttgagtcgccaccagccagccatagaggtgcagcagacg
cagcaacatcaacagacgcagcagcaacatgtccagcggcagcagcagcaagagcgcctg
gccagcggcggtgctggtgctaccgatccgcagggaggcatcagcaacatgaccaccgtc
aacgggggttacctgtggctcatcacacctgttgcagccagcatttctgtcgccattgtc
atcgccgctctggccggaccccagtggctcttcacggaggagaagctgcccaatgccaac
tacaatgggacggccaacttcaaagccctggacgatggcgcctacatcaccaagtacacc
aagtccagtctctggatattgtgcaccactctgccaggcctggatgctgactcgtacaac
tgcgttaagattgactacttttccaatgagggttatcagccggatccgcacgactcaacc
gcggcaataccctatacggtcaccaagtcgtgtcctattttcctggctgctggtgtattt
ctagtgatcagcttcatagtttttctaatccccacttgctcgcatcaaaacaatctgtat
tattttagcgcgggaattcttttcattgttagtggtctagtgatgctgattggattgatt
gcctatatatcaatactgaaggcggaaatcggatcgaagttaagaccccggtccaccctt
cagccagccctcatcaaggtctcctatggccagagcttcttcctcttcgtctttggattc
attgtcacggaattcgttggggtcttgaatatattcctcttcatcaatttgcaggaggtt
agctactacagtgtgagtaactga

DBGET integrated database retrieval system