KEGG   Drosophila melanogaster (fruit fly): Dmel_CG33672
Entry
Dmel_CG33672      CDS       T00030                                 

Gene name
CG33672
Definition
(RefSeq) uncharacterized protein
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: BolA DUF5664
Other DBs
NCBI-GeneID: 3771915
NCBI-ProteinID: NP_001027413
FlyBase: FBgn0061360
UniProt: A1Z933
Position
2R
AA seq 86 aa
MSKYDSKYLEEKLKRELQTEYVSVTDESDGCGGKFSAVIVSPAFSGKTLLQKHRLVNSTL
AEELKEIHAFSQKSYTPEEWEKVKAQ
NT seq 261 nt   +upstreamnt  +downstreamnt
atgagtaaatacgactcaaagtacctcgaggagaagctcaaacgggaactgcagacggag
tacgtgagtgttacggacgaatcagacggctgtggcggcaagttcagcgccgtaatcgta
tcgccagccttcagcggcaagacccttctccagaagcatagattagttaactcaacgctt
gccgaagaactgaaagaaatccatgcattctcccagaaatcctacacacccgaagagtgg
gagaaagtgaaagcccaatag

DBGET integrated database retrieval system