KEGG   Drosophila melanogaster (fruit fly): Dmel_CG33803Help
Entry
Dmel_CG33803      CDS       T00030                                 

Gene name
His3:CG33803
Definition
(RefSeq) histone H3
  KO
K11253  histone H3
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dme03036]
    Dmel_CG33803 (His3:CG33803)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dme04147]
    Dmel_CG33803 (His3:CG33803)
Chromosome and associated proteins [BR:dme03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    Dmel_CG33803 (His3:CG33803)
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dmel_CG33803 (His3:CG33803)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa
Motif
Other DBs
NCBI-GeneID: 3772149
NCBI-ProteinID: NP_001027285
FlyBase: FBgn0053803
UniProt: P02299
Structure
PDB: 

Position
2L
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtaccaagcaaactgctcgcaaatcgactggtggaaaggcgccacgcaaacaa
ctggctactaaggccgctcgcaagagtgctccagccaccggaggtgtgaagaagccccac
cgctatcgccctggaaccgtggccttgcgtgaaattcgtcgctaccaaaagagcaccgag
cttctaatccgcaagctgcctttccagcgtctggtgcgtgaaatcgctcaggactttaag
acggacttgcgattccagagctcggcggttatggctctgcaggaagctagcgaagcctac
ctggttggtctcttcgaagataccaacttgtgtgccattcatgccaagcgtgtcaccata
atgcccaaagacatccagttagcgcgacgcattcgcggcgagcgtgcttaa

DBGET integrated database retrieval system