KEGG   Drosophila melanogaster (fruit fly): Dmel_CG33887Help
Entry
Dmel_CG33887      CDS       T00030                                 

Gene name
His4:CG33887
Definition
(RefSeq) histone H4
  KO
K11254  histone H4
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dme03036]
    Dmel_CG33887 (His4:CG33887)
Chromosome and associated proteins [BR:dme03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    Dmel_CG33887 (His4:CG33887)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CENP-T_C TAF CENP-S Histone CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137
Motif
Other DBs
NCBI-GeneID: 3772509
NCBI-ProteinID: NP_001027337
FlyBase: FBgn0053887
UniProt: P84040 A0A0B4KFZ9
Structure
PDB: 

Position
2L
AA seq 103 aa AA seqDB search
MTGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgactggtcgtggtaaaggaggcaaaggcttgggaaagggtggcgccaagcgtcatcgc
aaagtgctgcgtgataacatccaaggtatcacgaagcctgctatccgccgtttggcccgt
cgaggcggtgtgaagcgcatatctggactcatatacgaggaaacgcgtggcgttctgaag
gttttcttggagaacgtaattcgtgatgccgtgacctacacggaacacgccaagaggaag
acagttacagccatggatgttgtgtacgctctgaagaggcaaggccgcaccctctacgga
tttggcggttaa

DBGET integrated database retrieval system