KEGG   Drosophila melanogaster (fruit fly): Dmel_CG33969
Entry
Dmel_CG33969      CDS       T00030                                 

Gene name
CG33969
Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K10262  F-box and WD-40 domain protein 4
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dme04121]
    Dmel_CG33969 (CG33969)
Ubiquitin system [BR:dme04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     Dmel_CG33969 (CG33969)
SSDB
Other DBs
NCBI-GeneID: 40252
NCBI-ProteinID: NP_001034034
FlyBase: FBgn0053969
UniProt: Q8SX44
Position
3L
AA seq 410 aa
MMSSRMSLKDLTIECLLLIFDYCSEGDLLCLCRADPALEYIIEAYYFYPLAYDLLLCGHR
NNPRIEQRNRRRLKNYERIELSRNWVSGTYFERPYFHHAQMFPTKLCLEADFLYITHACY
LRKYRRSSCDALHRRFDEEICTSAQTDISDFVKKNETIFAGRVCGSCFHYDTDSMVMTEQ
RMHPANEYLYCVDFVKDLYATSTDHCCRLWQRAQEFGMTHFDQVMHLPHAFRSLELSSDG
QWLYGGLYTDNGRQALRAVHVESGEELVFSSKTMSIYDLKLKDDQVIFTANFDSTFRMFD
RRVDRDVAIWDDPFDSSFYSLEYDGLHAVLVGTNRHARVNLYDIRMKKYVQLYFPGRTRS
HNGLSPVYSLACDSQYMFVATDHNMRVFDFKASCGIRRDYSNIVYKRSET
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgatgagctcccgcatgagcttgaaggatctgaccatcgaatgcctgctcctcatattc
gactattgctcggagggggacctactgtgcctgtgccgggcggacccggctctggagtat
attattgaagcctactacttctacccactggcctacgatttgctgctctgtggccaccgg
aataatccaaggatcgaacagagaaaccgaagacgcctgaaaaactatgaacgcatcgag
ctgtcaaggaactgggttagtggcacctatttcgaacgaccatacttccaccatgcccag
atgttccccaccaaactgtgcctggaggccgactttctgtacatcacacatgcctgctat
ctgcgcaagtaccggcggtccagctgcgatgcactgcatcgtcgcttcgacgaggagatc
tgtacgtccgcacagaccgacatctccgatttcgtcaaaaagaatgaaaccatattcgcg
ggaagggtttgtggatcgtgcttccactacgacaccgatagcatggtgatgacggagcag
aggatgcatccggccaacgaatacttgtactgcgtagactttgtcaaggatctgtacgca
accagcacagatcactgctgcagactgtggcagcgtgcgcaggagtttggaatgacgcat
tttgatcaggtgatgcatctgccgcacgcctttaggtctctggaactcagttcggatggc
cagtggctgtatggtggactatacactgacaacggtcgccaggccttgagggcagtccat
gttgaaagtggcgaggaattggtgtttagttccaaaacaatgtcaatttacgacctgaaa
ttgaaagatgaccaggtcattttcacggccaacttcgatagcacgtttcgtatgtttgac
agacgcgtggatcgcgatgtagccatttgggatgatccgttcgactcctccttctactcc
ttggagtatgatggtctgcacgcggtgctggttggcaccaacagacatgcacgggtcaac
ctttacgatataagaatgaagaaatacgtacaattgtactttccgggaaggacgcgaagt
cataatggcttgtcgccagtgtacagcctcgcctgtgatagccaatatatgttcgtggcc
accgatcacaatatgcgtgtctttgactttaaggcaagctgtggaattcggagagactac
agcaatattgtatacaaacgaagtgaaacttaa

DBGET integrated database retrieval system