KEGG   Drosophila melanogaster (fruit fly): Dmel_CG34025
Entry
Dmel_CG34025      CDS       T00030                                 

Symbol
CG34025
Name
(RefSeq) uncharacterized protein
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: F-box LRR_4 F-box-like
Other DBs
NCBI-GeneID: 3885633
NCBI-ProteinID: NP_001033987
FlyBase: FBgn0054025
UniProt: Q2PE06
Position
3L
AA seq 325 aa
MVDLNILNLNEDCLQHILKYLSIKDLVNLADTLPRFRQILLDRPPTSYPVHHGNDPDGVK
PVLYYSTVAIKLLRIVKNNVKTLGVIQGHSYDKEDLGNFVKDFRILTQGRNKIDLRYCLG
EMSRLEDMFRFSSCSRDYLSVNVPSCICYLADFFQLIPGLRELRLSGFAKCSDCVKTILK
CFPKLEELWIRGTCLKLRSDYELISQMKSLTKLSINVGGSNCLGPLTNLTELRSLYVESI
FSYISPIEIIEIIKKCKKLQFLFCYYINHGEQPHDSIANIFKSIRSTRDPNRQTPLQLHT
YLDPPLCEENRQLIDEAYFEYRRLP
NT seq 978 nt   +upstreamnt  +downstreamnt
atggttgacttaaatattttaaatttgaatgaagactgtcttcaacacattcttaagtat
ctaagcatcaaagatcttgtaaatttagcggataccctgcccaggtttcgacagattttg
ttggacagaccgccaacctcgtacccagtacatcatggaaacgatcccgatggtgtgaaa
ccagtattgtattactcaacagttgccatcaagctgttgaggatcgtcaagaataacgta
aaaactttgggagttatccaaggacatagttatgataaggaggatctaggcaactttgtc
aaagacttccgaattctaacacaaggaagaaacaaaattgatctgaggtattgccttgga
gaaatgtccagacttgaggatatgtttcgattttcgtcttgctctcgtgactatttgagt
gtaaacgtcccatcttgtatttgttaccttgcggatttttttcaacttattcccggtttg
cgggagcttcgactttccggatttgccaagtgttcggattgtgttaaaacaattttgaaa
tgctttcccaagctggaggaactctggattcggggaacctgcctcaaacttcgatctgat
tatgagctgatatcgcagatgaaatctttgacgaaactgtcgataaatgttggtggttct
aattgtctagggcctttgaccaatttaactgaactccgatctctttatgtggagagtatc
ttcagctacatatctccaattgaaattatagaaatcataaagaagtgtaagaagttgcaa
ttcctattctgctactacataaatcatggagaacagccacacgattccattgcaaatata
ttcaagagcattagatcgactcgagatcctaaccgtcaaaccccccttcaattgcacaca
tatttggatccaccattgtgtgaagaaaatagacaactaattgatgaagcctacttcgaa
tatcgccggctgccttga

DBGET integrated database retrieval system