KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3424Help
Entry
Dmel_CG3424       CDS       T00030                                 

Gene name
path
Definition
(RefSeq) pathetic, isoform D
  KO
K14209  solute carrier family 36 (proton-coupled amino acid transporter)
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dme04131]
    Dmel_CG3424 (path)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dme02000]
    Dmel_CG3424 (path)
Membrane trafficking [BR:dme04131]
 Autophagy
  Other autophagy associated proteins
   Others
    Dmel_CG3424 (path)
Transporters [BR:dme02000]
 Solute carrier family (SLC)
  SLC36: Proton-coupled amino acid transporter
   Dmel_CG3424 (path)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aa_trans
Motif
Other DBs
NCBI-GeneID: 39106
NCBI-ProteinID: NP_001261634
FlyBase: FBgn0036007
UniProt: Q9VT04
Position
3L
AA seq 471 aa AA seqDB search
MVNIVDSGSKHAPQEMEQFLPGEGKVMYKIQPRKSDTEQALAGNDFDPFALRDNPHPTTD
NETLTHLLKASLGTGILGMPFAFMCSGLIMGIFSTIFTAFICTHCSYVLVKCGHKLYYRT
RRTKMTFAEIAEAAFQKGPKWCRGFAPVAKFSILFGLFLTYFGTCSVYTVIVASNFEQLI
SYWTGTAVSLRMLICIMLVPLILIAWVPNLKYLAPVSMVANVFMGLGLGITFYYLVQDLP
PVEERESVVWSTLPQFFSITIFAMEAIGVVMPLENNMKTPQSFLGICGVLSQGMSGVTLI
YMLLGFLGYLRYGSATGESITLNLPIEEWPAQTVKVLISLAVYCTFGLQFFVCLEIIWDG
IKEKCKKRPTLVNYVLRTVLVTAAVVLAVAVPTIGPFMGLIGAFCFSILGLIFPVVIELI
VHWESGFGKYNWILWKNAIITLCGIGALVFGTQAAIKDIVKAYSNNENVGE
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggttaacatagtggacagcgggtcgaagcatgcgccccaggaaatggagcaattcctg
cccggcgaaggaaaagtcatgtacaaaatccaaccccgaaagtcggataccgagcaggcc
ttggctggaaatgactttgatcctttcgcattgcgggacaatccgcatccaacaaccgat
aatgaaactctcacgcatttgcttaaggcctccttgggaaccggtatcctgggcatgcca
tttgccttcatgtgctccggtctcatcatgggaatcttctccaccattttcaccgccttt
atatgcacgcactgcagttacgtgttggtaaaatgcggacacaagttgtactacagaact
cgccgcaccaagatgacctttgccgaaattgccgaggctgccttccaaaaaggaccaaaa
tggtgccgtggcttcgcgccagtggccaagttctccatcctgtttggtctgttcctgacg
tactttggcacctgctcggtgtacacggttattgtggcctcgaactttgagcagttgatt
tcctattggacgggaacggcagtgtcgctgcgcatgctcatttgcataatgctggtgccg
ttgatcctcatcgcctgggtgccaaatctcaagtacctggcacccgtgtcgatggtggcc
aatgttttcatgggcctgggactgggcattacgttctactatctggtccaggatctgcca
ccagtggaggagcgcgagtccgttgtttggagcacactgccgcagttcttctcgatcacc
atctttgcaatggaggcaatcggtgtggttatgccgctggagaacaacatgaagacgcca
cagagtttcctcggaatctgcggtgtgctcagccagggcatgtcgggcgtgacccttatt
tatatgctgctgggattccttggatatctgcgttacggttccgccaccggtgagagcatc
accctgaatctgcccatcgaggagtggcccgcccagacggtgaaggtgctcatttccctg
gccgtatattgcacatttggactgcagttctttgtgtgcctggagatcatctgggatggc
attaaggagaagtgcaagaagcgcccgacattggtcaactatgtgctgcgcacagtcctg
gtgaccgctgccgttgttctggccgtggctgttcctacaattggcccatttatgggtctc
atcggtgccttctgcttctccattctgggattgatcttcccggtggtcattgagttgatt
gtccattgggagagtggctttggtaaatacaactggatcctgtggaagaacgcaatcatc
acgttgtgcggcattggcgctcttgttttcggcacccaggcagccatcaaggatattgtg
aaagcctacagtaataatgaaaacgtcggagaatag

DBGET integrated database retrieval system