KEGG   Drosophila melanogaster (fruit fly): Dmel_CG34357Help
Entry
Dmel_CG34357      CDS       T00030                                 

Gene name
CG34357
Definition
(RefSeq) uncharacterized protein, isoform D
  KO
K12322  guanylate cyclase 2F [EC:4.6.1.2]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00230  Purine metabolism
dme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Dmel_CG34357 (CG34357)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dme01001]
    Dmel_CG34357 (CG34357)
Enzymes [BR:dme01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     Dmel_CG34357 (CG34357)
Protein kinases [BR:dme01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   Dmel_CG34357 (CG34357)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc Pkinase_Tyr Pkinase HNOBA
Motif
Other DBs
NCBI-GeneID: 5740349
NCBI-ProteinID: NP_001097681
FlyBase: FBgn0085386
UniProt: A8JQT1
Position
3R
AA seq 1685 aa AA seqDB search
MKLTTCQIAKVFPLLTAFFFLNSPSAASLSFGLSPTFASASASSSLSSSSSSSSHFHSEK
PLHSDVLVLRAAKPSRAIATSADAATRSVPASAAETTLGSKSIWPTAIQTKSPRNAREAG
RHKRQMQKPAIQQQPLQQQQQRINPPQQKRQQQQQQQQQVQHQAQRVGVLIPPSLHVDLT
HVQQGFQNFLDFFQLHLFNVTVDFLRDVDLSGFIKLLELPKYTSVIKTLNAGIMVASHVD
VDQNSTIYIGTPSQPRQQHRLHSKQEQEPHRHHHEDSKAKQFPAGEEESHSSGETEENHW
NDARIFSGHCHQLAEQLALDFNKTVVLWPCPRMKISSNFLPSFEAISLAVQSISTKLNWS
QVDIYIGDDNWGLGLAIAANLHVPYRIEIGRTIRDLHSQDKPGKAIIITAPLNDASTILL
LSTIELDWTEQARKDGQGSRPGRQHTKILLIDMAASSLDTQHGFYKYLSRMGGSQSDAFA
RNTGSPAEVVSSNLLVLTLLNDRHRLFLNAAGLMATMQNFRAPLNGNYKDPPPSGHRNAS
LHKLYPYRNLLPLYDTIVTTTTQSDTSETSPQFDFVVLDIVRDAPVATYKWRPLLILESD
PGSRGGGSVVEGGGSYISHSIHPGYDEWLLVSSVLLWQCGAICWTIAAICVCLLVIMIAG
IVAGGIAMRNYFLRKRLSKGPNKIVLSASDFVFPVDSRRVDEGIEAMLCCWLQQLQEFGG
PEVDKPDLLKGSIGSLKNLGFVIPGAAAPGSAGAITTTANGKSGSSATGSLARHNPAHLD
MRARYNGDLVQLKEVNINGSAELRTKAMDLLVMAHGLRHENINPLIGWLSDPNRTAMVFD
YCSRGSLQDVLIMDEIKLDWSFRLSLLTDLVRGMRYLHTSPLRVHGALTSRNCVVDARWV
LKITDYGLNSFYESQGLPPRTRSAKELLWTAPELLRNMKLHQHHHQHGRIQLGTQLGDVY
SFGIIMQEVVVRGEPYCMLSLSPEEIIVKIKKPPPLIRPSVSKGAAPPEAINIMRQCWAE
QPDMRPDFNSVYERFKMLNHGRKVNFVDTMFQMLEKYSNNLEELIRERTEQLDIERKKTE
QLLNRMLPSSVAEKLKMGLAVDPEEFSDVTIYFSDIVGFTTIAAHCSPVQVVDLLNDLYT
IFDATINAYNVYKVETIGDAYMVVSGLPVKIPDHAEQIATMALDLLHQSGRFNVKHLPGV
PLQLRIGLHTGPCCAGVVGLTMPRYCLFGDTVNTASRMESTGSSWRIHMSQETRDRLDAR
GGYAIEPRGLIDIKGKGMMNTFWLLGKKGFDKPLPAPPPIGESHGLDESLIRNSITLKAQ
ANKSRTSTNPSSSQSSSLAGESVEVKVEITPPTNADLASGTNLPNSYSLDSNSTNTISPN
ATLCPEFPGKTTPSSTSPQSRKLSELTPENLLNPNSFNRLPSSTGGSSSRLYKKIEEMMD
LSSPYNHYKCLSPSESNLTQFYDGKYLYGSVAGGAGGGQAGGGACASIALSGSGCGGGAS
RFDSKPGSSRLLRRQFSLDRDDQQAKGEQQHHQHSLQANTYSGLVGGCGGGVKSSMLDIP
LLHDTTRSPKGTLTRSHKQNSASITQDLEKIEEIPLSPASSQHHSSLDSNLNRSPPSTLE
AQSPPLPPMSPPQLSAPTSPAPSRTLNGIYAHNSNSTSSHGAANNNNGTHPGPELTLNAE
QLLSR
NT seq 5058 nt NT seq  +upstreamnt  +downstreamnt
atgaagttaacaacctgtcaaattgctaaagtatttccgctgttgacagccttcttcttc
ctcaattctcccagcgcagcctcattatccttcggtttgagtcccaccttcgcctccgcc
tccgcctccagctccttgtcctcgtcatcgtcctcgtcctcccactttcactcagaaaaa
cccctccactcggatgtactcgtcctgcgagcggccaagccatccagggccattgcaaca
agcgcagatgcggctacgcggtctgtgccagcgtcagcggcagaaacaacacttggcagc
aagtcaatttggccgacagctatacaaacaaaaagtccacgtaatgcgcgtgaagctgga
cgtcacaaacgtcaaatgcaaaagcccgcaatccagcagcaaccactgcagcagcagcaa
cagcgcattaatcccccgcagcaaaagcgacagcagcagcagcagcagcagcagcaagtg
caacatcaggctcaacgagtgggcgttttaatacctccttcgctgcacgttgatttgacg
catgtgcaacagggctttcagaatttcctcgactttttccaactgcatttatttaatgtc
accgtcgattttctacgtgatgtggacttaagcggcttcattaaattactcgagctgccc
aagtacacgagcgttataaagactttaaatgcgggcattatggtagccagccacgtggac
gtggaccaaaattccactatctacattggcacgcccagccagccacgtcagcaacatcgg
ctgcattcaaagcaggagcaggagccccatcgtcatcatcatgaggactccaaagcaaaa
cagtttccagcgggcgaggaggaatcccattcatcgggcgagaccgaggaaaatcattgg
aacgacgcccgcatcttctcgggtcactgtcatcagctggcggagcaactggccctcgat
ttcaataagaccgtcgtcctgtggccctgtccgcgaatgaaaatctccagcaattttctt
ccgtcattcgaagcaatttccctagcggtacaaagcatttccaccaagttgaactggtcg
caagttgatatctatattggcgacgacaattggggcctgggactggccattgccgccaac
ttgcatgtgccgtatcgcatcgaaattggcaggacaatacgtgacctgcattcgcaggat
aagccgggcaaagcaattattatcacagccccgctgaacgatgcgagcaccatcctcctg
ttgtccaccatcgagttggactggacggagcaggcgaggaaagacggtcagggttcaagg
cccgggaggcagcacaccaaaatcctgctcatcgacatggcggccagctcattggacact
cagcatgggttctacaaatatttgtctcggatgggcggatcacagagtgacgccttcgca
cgcaacacgggttctccagccgaagtggtcagcagcaatcttttggtgctgactctgcta
aacgacagacatcgactatttctgaatgcggccggactgatggcaacaatgcagaatttt
cgcgcgcccctcaacggcaactacaaggatccaccaccctccgggcatcgcaatgccagc
ctgcacaagctgtacccgtaccgcaatctcctcccgctctacgatacgattgtgaccacc
actacccaatcggacacttcagaaaccagtccccaatttgattttgtggtgctggacatc
gttagggacgccccggtcgccacttacaagtggagaccactgcttattctggagagcgac
ccaggaagtcgaggaggtgggtcggtggtggaagggggtggctcctacatctcccactcc
atacaccctggatacgacgagtggttgctggtcagcagtgtcctcctgtggcaatgtggt
gccatctgctggaccatcgcggcgatctgtgtttgcctgttggtcatcatgatagcgggc
atagtagccgggggaatcgccatgaggaactacttcttacgtaagcgtctctccaagggg
cccaacaaaatagtcctttctgccagcgattttgtttttccagtggattcccgaagggtt
gatgagggtatagaggccatgctatgctgttggctacagcaactgcaggagtttggaggc
ccggaagtagacaaaccggatcttcttaagggttccattggctcccttaagaatctaggt
ttcgtgattcccggcgcagcagctccgggatcggctggagccatcacaaccacggcgaac
gggaaaagcggctcttccgccactggcagcttagccaggcacaaccccgcccatctggac
atgagagctcggtataacggagatctcgtgcagcttaaggaggtgaatataaacggatct
gcggaattgcgcaccaaggcaatggatctactcgtaatggcccatgggctgaggcacgaa
aatataaaccccttaattggatggctatcagatccaaaccgcacggccatggtctttgat
tactgctccagaggatcgctgcaagatgtgcttatcatggatgagatcaagctggactgg
tcgtttcggctaagcttgcttacggatctggtcaggggcatgcgctacctacacacctcg
cctttgagagttcatggtgccttgacctcgagaaactgcgtagtggatgctcgatgggtc
ctgaaaatcacagactatgggttgaattctttttatgaatcgcagggacttccgccaaga
accagaagtgctaaagagctattatggacagctcctgagctccttcgaaacatgaagctg
caccagcatcaccatcagcacggccgcattcagttgggaacccaacttggagacgtatat
tccttcggaatcataatgcaggaggtggtagtcaggggagagccctactgcatgctctcc
ctctcgccggaggaaataatagtgaaaattaaaaagcccccgcctctgatacggccctcc
gtttccaagggagccgctcccccggaggccatcaatatcatgcgccagtgctgggccgaa
cagcctgacatgcgtcccgacttcaactccgtgtatgagcgcttcaagatgctgaaccat
ggacgcaaggtaaactttgtggacactatgttccaaatgctcgagaagtactcgaataac
ttggaggagttgattcgggagcgcactgaacaactggacattgaacgaaagaagactgaa
cagctgctgaatcgcatgttaccaagctcggttgctgaaaaactaaagatgggcttggcc
gtcgacccggaagaattttccgacgtaaccatatacttcagtgacattgttggttttaca
acaatcgccgcccattgcagtccggttcaagttgtagatttgctcaacgatctctatacg
atcttcgatgccacaatcaacgcctacaacgtttacaaggtggagacaatcggcgatgcg
tatatggtggtgagcgggctacccgtaaaaatacccgaccatgctgagcagatagctacc
atggccttggatcttctgcatcaaagtggtcgtttcaatgttaagcatcttcccggagtt
ccactccaactgagaatcggcctccacacgggtccgtgttgcgccggagtggtgggtctc
acgatgcccaggtactgtctttttggggacacagtgaacacggcatcgagaatggagtcg
accggatcctcctggcgcatccatatgtcccaggagacgcgggatcgactggatgctcgg
ggtggctatgccatcgagccaagaggtctcatcgacatcaagggaaagggcatgatgaac
accttctggctgctgggaaaaaaaggattcgataagcccctgcccgcaccgccgcctatt
ggagaatctcacggcttggatgagtcccttatacgcaactcaataacgttgaaggcgcag
gccaacaagtctcggacgagcacaaatccctcctcttcgcagagctcctcgctggctggg
gaatccgtcgaggtgaaggtcgagataacaccgcccaccaacgcagacctggcttccggg
accaatctccccaactcatactccctggactccaattccaccaacacaattagccccaac
gccaccctttgtccggagtttccgggcaagacaacccccagcagtaccagtccacagtcg
cggaagctctccgaactgactccagaaaatctactcaacccgaacagctttaaccgtctg
ccaagctccacaggaggatccagctcaaggctgtacaaaaagatcgaggagatgatggac
ctcagttcgccgtacaaccactacaaatgcctcagtcccagcgagagcaacctcacccag
ttctacgacggaaaatacctctacggcagtgtggcgggcggagcgggtggtggacaagcg
ggcggaggcgcctgcgcctcgatagccttgagcggaagtgggtgtgggggaggagcctct
cggttcgacagcaagcccggctccagtcgccttctgcgtcggcagttcagcttggatcgc
gacgaccagcaggcgaagggagagcagcagcaccaccagcactccctgcaggcaaacacc
tactcggggttggtgggcggttgtggtgggggtgtcaagagctccatgctggacatacct
ctcttgcacgacactactcgcagtcccaagggaacgctaacgcggtcccacaagcagaac
tctgcctcgatcacccaggatctggagaagatcgaggagatcccgctgtcgccggcctcc
tcgcagcaccacagtagcctggacagcaatctaaaccgcagtccgccatcaacgctggag
gcgcagtcgccgccgctgccgcccatgagtccgccccagctttccgcccccacatcgccg
gccccgtccaggactttgaacgggatctatgcccacaacagcaatagtaccagttcccat
ggtgcagccaacaacaataatggcacccatcccggcccagagctgacccttaatgcagag
caactgctgagcagatag

DBGET integrated database retrieval system