KEGG   Drosophila melanogaster (fruit fly): Dmel_CG34368
Entry
Dmel_CG34368      CDS       T00030                                 

Gene name
Fili
Definition
(RefSeq) Fish-lips, isoform C
Organism
dme  Drosophila melanogaster (fruit fly)
Motif
Pfam: LRR_8 LRR_4 LRR_5 LRR_1 LRR_9 TMEM206
Other DBs
NCBI-GeneID: 5740472
NCBI-ProteinID: NP_001097402
FlyBase: FBgn0085397
UniProt: Q5U1A7
Position
2R
AA seq 738 aa
MPDHTRVTATTRSRPWLCGAIPVLLLLLLTLVILPPETTAFCPSKCQCLGGEANSRALCV
DAALEDVPIQLNPETKYINLTVNRIRTLEFSLPFYMKLEILDLSQNIIETLGSKNFEYQS
ELRTLNLSRNLVSSLHKHAFKGLTNLLLLDLSFNRIETVHPTALSDLASLVELDLTNNNI
VSLEDNCFKGMNTLEVLVFRNNRLLDVPASNLWHLHALKSLDMSLNLVEFVRNDSFEGLK
ELLALSVQGNVMSELDLSAFEGLISLKHLDLSDNNLTMVPTQQLSKLSNLTYLNLGGNRF
SQLPAVAFLNLFHLRELHLSRLDFLQRIDSRAFVDNTHLQTLHLNNNPQLSDIPMRLFQG
NPNILEVYMQSNSLQTLYSAQFPVDQLQKLYLGDNPLQCNCSLLWLWRLVTGNFEGVDPG
MEHAAGGAVAALAKEADDEELADEATAVASTDDGVAALAAYIAEQHIVNALHTTEPSAYE
LATSSSNRNSGILRMDRQQIGCDIWRDKVRTRRKLLTMSEGEITCPAHIVTVVCAVITCL
LVAMIGISVLYYLRFVKRRRKLLHERGPMRTSKSIINVHDRILQGHNPGGLGLGMSMTLG
GGNHVNGLGMTLNYPHHAQTLQAHHHYHQAMPLQSHGGNGNHEYQQTTLPQLDKLELERY
LAAQTIANEYRALKPWELPVKEADDEPEHLYERFDHYEYPDTHTMSKLKQAASLNHSNSS
AGPSPVPPSSGKPHVVYV
NT seq 2217 nt   +upstreamnt  +downstreamnt
atgcctgaccacacgagagttaccgcaacgacaaggagtaggccatggctatgtggagcc
atcccagtgctgctgctcctcctgctgactctcgtaatcctgcctccggaaaccaccgcc
ttctgcccctcgaagtgccagtgtttgggcggcgaggcaaatagtagagcgttgtgcgtg
gacgccgctctggaggatgtgcctatccaacttaatccggaaacgaaatacattaacctt
acagtaaatcggattcgtacgctagaattctcgctgccattctacatgaagcttgagatc
ctggatctctcgcagaatatcatcgaaacgctgggctcgaaaaacttcgagtaccaatcg
gaactgagaaccctgaatctgagccggaatttggtcagttccctgcacaaacatgccttc
aagggtctgaccaatctgttgcttcttgatctcagtttcaatcgcattgagacagtgcat
cccaccgctctaagtgatctcgcctccctggtggagctggatcttacgaataacaatatt
gtcagcttggaggacaactgcttcaagggcatgaacaccctagaggttctcgtgttccgg
aataatcgattgctagacgttccagccagtaatctttggcatttgcatgccctcaagagc
ctggatatgtccttgaatctggtcgagtttgtgcggaatgacagtttcgagggcttaaag
gagcttttggccctcagcgtgcagggcaatgtgatgagcgaactggatttgagtgccttc
gagggacttatatccttgaaacatctggatctgtccgataataatctcacgatggtgcct
acacagcagctctcgaaactctcgaacctcacctatttgaacctgggcggcaatcgcttt
tcccagctgcctgccgtcgccttcctgaacctgtttcatttgcgcgaattgcatttgagc
cggctggacttcttgcagcgcatcgattcgagagcctttgtggacaacacgcacctacaa
acgctccacctgaacaacaatccccagctgagcgacataccgatgcgcctgttccaggga
aaccccaacattcttgaggtctacatgcagagcaacagcctgcagaccttgtactcggct
cagttcccggtggatcagctgcagaagctctacctcggggacaacccgctgcagtgcaac
tgctcgttgctgtggctctggcgattggtaaccggcaacttcgagggagtcgatccgggc
atggagcacgcagccggtggtgctgtggctgctctggccaaggaagccgacgacgaggag
ctggcggatgaggcaaccgctgtggcatccacggacgacggagtggccgctttggctgcc
tacatagccgagcagcatatagtgaatgccctgcacaccaccgaacccagtgcctatgag
ctggccacgtcctcctcgaacagaaactccggtatcctgcgaatggatcgacagcagatc
ggctgcgacatctggcgggataaggtgcgtacgaggaggaagctcttgaccatgagcgag
ggcgagatcacctgtcccgcccacattgttactgtggtgtgtgcggtgatcacatgcctg
ctggtggccatgattggaatcagcgtgctgtactacctgcgctttgtcaagcggcggagg
aaattgctccacgaacggggtcccatgcggaccagcaagagcatcatcaacgttcacgat
cgcatcctgcagggtcacaatcccggtggcctcggcctgggcatgagcatgaccctgggt
ggcggtaatcatgttaatggattgggcatgaccctcaattatccgcatcatgcacaaacc
ctgcaggcccaccatcactaccatcaggccatgccactgcagtcccatgggggcaatggt
aaccacgagtaccagcagacgactctgccacaactggacaaactggaactggagcgctac
ctggcggcccagaccatagccaatgaataccgggccctgaagccctgggaactgcccgtc
aaggaggcggatgatgaaccggagcatctttacgagcggttcgatcactacgagtatccg
gacactcacaccatgagcaagctgaagcaggctgcgtccttgaaccactccaactcctcg
gcaggtccttcgcccgttccaccctcatcgggaaaaccgcatgtggtctacgtatga

DBGET integrated database retrieval system