KEGG   Drosophila melanogaster (fruit fly): Dmel_CG34455
Entry
Dmel_CG34455      CDS       T00030                                 

Gene name
Pdxk
Definition
(RefSeq) pyridoxal kinase
  KO
K00868  pyridoxine kinase [EC:2.7.1.35]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00750  Vitamin B6 metabolism
dme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Dmel_CG34455 (Pdxk)
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.35  pyridoxal kinase
     Dmel_CG34455 (Pdxk)
SSDB
Motif
Pfam: Phos_pyr_kin PfkB
Other DBs
NCBI-GeneID: 39066
NCBI-ProteinID: NP_996031
FlyBase: FBgn0085484
UniProt: Q7KUC2
Position
3L
AA seq 304 aa
MAGATNADIKRVLSIQSHVVHGYVGNKVATYPLQLLGFDVDPLNSVQFSNHTGYKTFKGP
VSNEKELATIFEGLEENELLPLYSHLLTGYIGNPLFLRQVGHILKKLRQANPGLVYVCDP
VMGDNGQLYVPKELLPVYRDEIIPLADIITPNQFEVELLTEKEVRSEAAVWEAMEWFHQR
GIKTVVISSSDLGQPGVLRAFLSQQNGPRLAIDIPKQGGKDLVFTGTGDLFASLFLAHSH
GSKDIANVFEKTIASLQAVIKRTVASLPNGGNGPVKAAERELKLVQSKTEIEQPQVLLKA
QRLN
NT seq 915 nt   +upstreamnt  +downstreamnt
atggcaggtgcaacaaatgcggacatcaagcgggttctatccatccagagccatgtggtc
cacggctatgtgggaaacaaggtggccacctatccactgcagctgctgggtttcgatgtg
gatccactgaactcggtccagttctccaatcatacgggctacaagacctttaagggtccc
gtctccaatgaaaaggaattagccaccattttcgagggtctggaggagaacgagctgctg
ccattgtactcacacctcttgaccggctacattggaaatccattgttcctacgccaggtg
ggccacattctcaagaagctgcgtcaggctaatcctggcctggtgtacgtctgtgatccg
gttatgggtgacaatggtcagctctatgtgcccaaggagctcttgcccgtgtatcgggac
gagatcattccactagcggacatcatcactcccaatcaattcgaagtggagctgctcacg
gaaaaggaggtacgcagcgaggcggctgtttgggaggcaatggagtggttccatcagcgt
ggcatcaagactgtggtcatttccagcagtgatcttggccagcctggcgttctgcgtgct
ttccttagccagcagaatggtccccgcctggccattgatattccgaagcagggtggcaag
gatttggtcttcactggcaccggcgatctcttcgcctcccttttcctggcccacagtcat
ggcagcaaggatatagccaatgttttcgagaaaaccatcgccagtttgcaggcggtgatc
aagcgaactgtggcttcgctgcccaacggtggaaacggcccagtcaaagcagccgaacgg
gaactaaagctggtgcagtccaagacggaaattgaacagccccaggtgctcctcaaagcg
cagcgacttaactag

DBGET integrated database retrieval system