KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3466
Entry
Dmel_CG3466       CDS       T00030                                 

Symbol
Cyp4d2
Name
(RefSeq) cytochrome P450-4d2, isoform B
  KO
K15001  cytochrome P450 family 4 [EC:1.14.-.-]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:dme00199]
    Dmel_CG3466 (Cyp4d2)
Enzymes [BR:dme01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-  Acting on paired donors, with incorporation or reduction of molecular oxygen
    1.14.-.-  
     Dmel_CG3466 (Cyp4d2)
Cytochrome P450 [BR:dme00199]
 Cytochrome P450, animal type
  CYP4 family
   Dmel_CG3466 (Cyp4d2)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 31192
NCBI-ProteinID: NP_001284806
FlyBase: FBgn0011576
UniProt: Q27589 X2JI29
Position
X:2176006..2178728
AA seq 501 aa
MLGVVGVLLLVAFATLLLWDFLWRRRGNGILPGPRPLPFLGNLLMYRGLDPEQIMDFVKK
NQRKYGRLYRVWILHQLAVFSTDPRDIEFVLSSQQHITKNNLYKLLNCWLGDGLLMSTGR
KWHGRRKIITPTFHFKILEQFVEIFDQQSAVMVEQLQSRADGMTPINIFPVICLTALDII
AETAMGTKINAQKNPNLPYVQAVNDVTNILIKRFIHAWQRVDWIFRLTQPTEAKRQDKAI
KVMHDFTENIIRERRETLVNNSKETTPEEEVNFLGQKRRMALLDVLLQSTIDGAPLSDED
IREEVDTFMFEGHDTTTSAISFCLYEISRHPEVQQRLQQEIRDVLGEDRKSPVTLRDLGE
LKFMENVIKESLRLHPPVPMIGRWFAEDVEIRGKHIPAGTNFTMGIFVLLRDPEYFESPD
EFRPERFDADVPQIHPYAYIPFSAGPRNCIGQKFAMLEMKSTVSKLLRHFELLPLGPEPR
HSMNIVLRSANGVHLGLKPRA
NT seq 1506 nt   +upstreamnt  +downstreamnt
atgctgggtgttgttggggtgctcctcctggtggcgttcgccacactgctgctgtgggat
ttcctctggcgcaggcggggcaatggtatattgccgggtccgcggccacttcccttcctg
ggcaacctgctcatgtatcgcggtctagatcctgaacaaataatggactttgtcaagaag
aaccagcgcaagtacggtcgcctttacagggtgtggattctccaccagttggccgtcttc
tccacggatccccgagacattgagttcgtcttgagcagccagcagcatataaccaagaat
aatctgtacaagctacttaactgctggctgggcgatggattgctgatgagcacgggcagg
aagtggcatggacgcagaaagatcatcacgcccaccttccacttcaagattttggaacag
ttcgtcgagatattcgaccaacaaagcgccgtaatggtggagcagcttcagtcgcgcgcc
gacggcatgactcccattaacatctttccggtgatttgtctcactgccctggatataatc
gcagaaactgcaatgggcacaaaaatcaatgcccaaaaaaatcccaatctgccctatgtc
caggctgtcaatgatgtcaccaacatcttgattaaacgttttatccacgcttggcagcgg
gtggactggattttccggctaacgcagccaacagaagctaaacgccaggacaaagctatc
aaggtaatgcacgactttaccgagaacattatccgtgagcggcgtgaaacgctggttaac
aactcgaaggaaacaaccccagaagaggaagttaatttcttgggccaaaagcgacggatg
gctctgctggatgtgctgctgcagtccacaatcgatggcgccccgttgagcgatgaggat
atccgcgaagaggttgacacgtttatgttcgagggccatgacacgactacctcggcgatt
tcattctgtttatatgaaatctcaaggcatccggaggtccaacagcgtctgcagcaggag
atccgcgacgtcctcggcgaggatcgaaagagcccagttacccttcgtgatcttggtgag
ctgaagtttatggagaacgtaattaaggagtcgctgcgcctgcacccgccagtgcccatg
atcggtcgctggttcgccgaggatgtggaaatacgtggcaagcatattccagcaggcacc
aactttacgatgggcatctttgttcttcttcgtgatcctgagtacttcgagtctcccgat
gagttccgacctgaaagattcgatgcggatgtcccgcagattcatccgtatgcgtacatt
cctttctccgctggaccaagaaactgtatcggccagaagtttgccatgctggaaatgaag
agcaccgtcagcaagctgctccggcacttcgagctgctgcccttgggtcctgagccccgc
cactcgatgaacatcgtcctgcggtcggccaacggcgttcatcttggcctgaaaccgcgc
gcctaa

DBGET integrated database retrieval system