KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3478
Entry
Dmel_CG3478       CDS       T00030                                 

Gene name
ppk
Definition
(RefSeq) pickpocket
  KO
K03440  acid-sensing ion channel, other
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:dme04040]
    Dmel_CG3478 (ppk)
Ion channels [BR:dme04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   Dmel_CG3478 (ppk)
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 34843
NCBI-ProteinID: NP_477232
FlyBase: FBgn0020258
UniProt: Q7KT94
Position
2L
AA seq 606 aa
MAEIREDEEEKKSGISILPGPELLALPGFDTRASIASAALSDVPSDVIIKSRIRYGSPLS
ACKGLLLEYAKSTTIHGIRYIFEVHRPIYEKLYWLFFTCISVYFAVSLIWDTYLKWQESP
VILGFDETLVPVHKIPFPTITICPEIKMERNVFDYTNVSRQLWEEYKQNGNISDLDDEDL
ARMAVAMHICDSEVVQRFTPLLSQLNPPNVDVTQTLIDLSISKNETGPFCKWNGRFYFCD
KIFDFVATDEGICYQFNGLRPKDIYRDEKFISYVDPDVVDFNKYFDVDLPPWNNITGNWS
LDTGFVDQGQNAYPQRTVFSSVKNGFFAFLQGLQHNFDYDCRSFKQGYKVFLNSPESVPL
TTGNYILVPHGDEVLVSVLPAYVVSTDNLHEITPEKRQCLFDDERSLRFFRSYSQSNCQT
ECLANYTVSKCGCAKFWMPKPLGTPVCGLKDINCYTSAQDELYTLMQNQTMAKSIDESVD
ITCNCMPACTSLEYNFEISRAKYDVAKTIRAFREEYEHTDAIGSRLSVYFKEHQFTAIKR
TILFGVSTLISNCGGICGLFMGISCLSFLELIYFFCMRICGSCRDRRKHKIQQQNSVDLP
EEKSEN
NT seq 1821 nt   +upstreamnt  +downstreamnt
atggccgagatcagggaggatgaggaggaaaagaagtcgggcatcagcattctgcccggt
ccggaactattggcgcttcccggcttcgatacccgggccagtattgcatcggctgcatta
agtgatgttccaagtgatgtgatcattaagtctcgcattcgatacggcagtcctctgtca
gcctgcaaaggattacttttggagtatgcgaagagcacgaccattcacggcatacgctac
atcttcgaggttcacagaccgatctatgaaaaactttattggcttttcttcacgtgcatt
tccgtttactttgccgtttcacttatctgggacacctatctaaagtggcaggaatcgccg
gttattctaggtttcgacgagactttggtgccagtgcataagataccgtttcccacaatt
accatttgtccggaaatcaaaatggaacgcaatgtctttgactatactaacgtatcgcga
caactttgggaggagtacaaacagaatggcaatatcagcgatttggatgatgaggacctg
gctcgaatggcggttgcaatgcacatctgtgattcggaagtggtgcagcggtttactcca
ttgctatcgcagctaaatccgccgaacgtggacgtaacccaaactctgattgacttgagt
atatcgaagaatgagacgggtccgttttgcaagtggaatggtcgcttttacttctgtgac
aagatcttcgactttgtggccaccgacgagggtatctgctatcaattcaatggactgcga
cccaaggacatttatcgtgacgagaagttcatcagctatgtggatccggatgtggtggac
ttcaacaagtacttcgatgtggatttgcctccgtggaacaacataactggcaattggtca
ctggacactggattcgtggaccagggtcagaatgcgtatccccaacggacggtgttctca
tcggtgaaaaatgggttcttcgcctttctgcagggtttgcagcataatttcgactacgat
tgtcgcagtttcaaacagggctataaggtctttctcaactccccggagagtgtgccgctg
acgacgggcaattatatcctagtccctcatggcgatgaggtcctggtcagtgtgctgcca
gcatatgtcgtgtccactgacaatttgcacgaaattacacccgaaaaacgccaatgtctg
ttcgatgatgagcgatcgctacgattcttccgttcctattcccagagcaactgccaaacc
gaatgtctggccaactatacggtttccaaatgcggttgtgccaaattctggatgcccaaa
cctcttggcactcccgtttgtggcctcaaggacatcaattgctacacatcggcccaggat
gaactctacacgctgatgcaaaaccaaacgatggccaagagtattgatgaaagtgtggac
atcacctgcaactgcatgccagcctgcacttcgctggaatataatttcgagatatctagg
gccaaatacgatgtggctaaaaccattcgagccttccgcgaagaatacgagcatacggac
gcaattggatcccgactctccgtctactttaaggagcatcagtttacggccattaaacgc
actattcttttcggggtatccacattgatttccaactgcggcggtatctgcggattgttt
atgggaatctcatgtctgagtttcctggagctaatctacttcttctgcatgagaatctgt
ggcagctgccgcgatcgcaggaagcacaagatacaacagcagaactcagtggatttacca
gaggaaaaatctgagaactag

DBGET integrated database retrieval system