KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3595
Entry
Dmel_CG3595       CDS       T00030                                 

Symbol
sqh
Name
(RefSeq) spaghetti squash, isoform B
  KO
K12757  myosin regulatory light chain 12
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:dme04812]
    Dmel_CG3595 (sqh)
   04147 Exosome [BR:dme04147]
    Dmel_CG3595 (sqh)
Cytoskeleton proteins [BR:dme04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     Dmel_CG3595 (sqh)
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Dmel_CG3595 (sqh)
SSDB
Motif
Pfam: EF-hand_6 EF-hand_7 EF-hand_1 EF-hand_5 EF-hand_8 DUF3741 SPARC_Ca_bdg
Other DBs
NCBI-GeneID: 31554
NCBI-ProteinID: NP_001284928
FlyBase: FBgn0003514
UniProt: P40423 F6J1D0
Position
X
AA seq 174 aa
MSSRKTAGRRATTKKRAQRATSNVFAMFDQAQIAEFKEAFNMIDQNRDGFVEKEDLHDML
ASLGKNPTDDYLDGMMNEAPGPINFTMFLTLFGERLQGTDPEDVIKNAFGCFDEENMGVL
PEDRLRELLTTMGDRFTDEDVDEMYREAPIKNGLFDYLEFTRILKHGAKDKDEQ
NT seq 525 nt   +upstreamnt  +downstreamnt
atgtcatcccgtaagaccgccggacgtcgcgccaccaccaagaagcgcgcccaacgcgcc
acctccaatgtgttcgccatgttcgatcaggcgcagattgccgagttcaaggaggcattc
aacatgatcgaccagaaccgtgatggcttcgtcgagaaggaggatctgcacgacatgctg
gcctcgctgggcaagaacccaacggacgactatctcgatggcatgatgaacgaggcgccc
gggcccatcaacttcaccatgttcctcacgctcttcggcgagcggctgcagggcaccgat
cccgaggatgtgatcaagaacgccttcggctgcttcgacgaggagaatatgggcgtcctg
cccgaggatcgcctgagggagctgctgaccaccatgggtgatcggttcacagacgaggat
gtggacgagatgtatcgggaggcgcccatcaaaaacggtctgttcgactacctcgaattc
acgcgcatccttaagcacggtgccaaggacaaggatgagcagtaa

DBGET integrated database retrieval system