KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3615Help
Entry
Dmel_CG3615       CDS       T00030                                 

Gene name
Atg9
Definition
(RefSeq) Autophagy-related 9, isoform B
  KO
K17907  autophagy-related protein 9
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04136  Autophagy - other
dme04137  Mitophagy - animal
dme04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:dme00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    Dmel_CG3615 (Atg9)
   04136 Autophagy - other
    Dmel_CG3615 (Atg9)
   04137 Mitophagy - animal
    Dmel_CG3615 (Atg9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dme04131]
    Dmel_CG3615 (Atg9)
   03029 Mitochondrial biogenesis [BR:dme03029]
    Dmel_CG3615 (Atg9)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dme02000]
    Dmel_CG3615 (Atg9)
Membrane trafficking [BR:dme04131]
 Autophagy
  Autophagosome formation proteins
   ATG9 transmembrane protein
    Dmel_CG3615 (Atg9)
Mitochondrial biogenesis [BR:dme03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    Dmel_CG3615 (Atg9)
Transporters [BR:dme02000]
 Other Transporters
  Others
   Dmel_CG3615 (Atg9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: APG9
Motif
Other DBs
NCBI-GeneID: 36821
NCBI-ProteinID: NP_001261023
FlyBase: FBgn0034110
UniProt: A0A0B4KF86
Position
2R
AA seq 852 aa AA seqDB search
MSSPHINYRSLAEEAASPFLEHHPSTGQGPSKTQDAKANAAAAHLDPLGEHGLEQPLDEH
DTEHEGEDTPRNSGVMIHMVPETGRARWNHIEDLDSFFSRMYQYQQKHGFTVIVVDEMLQ
VLEFGFVVWLLAFVMHCVRFDVLFGDTPPGGLNPNKTTLSDVMYPTGECLANFTWVTYLV
VFIAAIYLGIRLLKMVYHITQYADIKRFYNSALHIEDSDLDNFTWHEVQQRIRRVQAEQH
MCIDKESLTELDIYHRVLRFKNYLVALMNKQLLPVRFHIPLYGEVVSLSRGMLFNIDFIL
FRGPGSPFQNNWQLRDEFAVRSNQTELAQRLSKLILGVALLNLVLAPVIFVWQLIYFSFS
YANILRKEPGALGLRTWSNYGRLYLRHFNELDHELDARLNRAYDYADRYLNSFSSPLAAV
IAKNLLFISGGLLLLILALGIYEEHVFQVEHLLAILAGLGAIGVVCRTLIPDENLVWCPE
QLMTAILAHVHYLPSEWRQQAHTTKVRQEFSNFFQFKAGYLLSEIFSPFVTPFVLIFVFR
PKAIELVRFFRTFTVSVRGVGNVCSFAQMDVRKHGNPDWQLTSELEEMTRATAQQPQQEP
QQQSLAGGKTEMSLLRFTLNNPEWQMPKEAKQFLRGVREHAVGELVQAKTSMVQENPLTN
SLISFGTMGADYCSIANSVLTAQVTPQQLEISQSLRPGLGPVSGGFPVAASDFRQMLQQN
LSASVGPLDSMRRLRLSRAEGRLEGPTDTLLYGLCGVDPRVGSTPLNVGVADMCLSALYL
HELNQQKRQARQSRIDEAEDERPGTSHWPPRPPAAPSADTGFGSRHTVITSKAAESTPLL
GSIRSXQRPEWI
NT seq 2559 nt NT seq  +upstreamnt  +downstreamnt
atgtctagcccacatatcaactaccgctccctggccgaggaggcggccagtccgttcctg
gagcaccatccctccacaggccaaggcccatccaaaacacaagacgcaaaagcgaacgca
gctgctgcgcatttagaccccctcggtgaacacgggctggagcagccgctggatgagcac
gacaccgagcatgagggcgaggacacgcctcgaaacagtggcgtcatgatccacatggtt
ccggagacggggcgtgcgcggtggaaccacatcgaggaccttgactcgttcttctcgcga
atgtatcagtaccagcagaagcacggattcacagtgattgtagtggacgaaatgctacag
gttctggagtttggtttcgtcgtctggctacttgcctttgtgatgcactgcgtccgattt
gacgtgctctttggggacacccctccagggggacttaaccccaacaagacaactttatcc
gatgtgatgtaccccacaggcgagtgcttagccaacttcacttgggtcacgtacctggtt
gtgttcatagccgctatctatttgggcataaggcttctgaaaatggtgtaccatattacc
cagtacgccgatataaagagattctacaactctgcgcttcatatcgaggattcggatctg
gacaactttacgtggcacgaggtgcaacagcggattcgtcgcgtccaggccgaacagcat
atgtgcatcgacaaggagtcgcttacggaattggacatctatcaccgagttctgcgcttc
aagaactacctagtggcactgatgaacaagcaactgctgcctgtaaggttccacataccg
ctgtatggcgaagtggtctcgctgagtagaggtatgttgttcaacattgacttcatcttg
tttcgcggccctggatctcccttccagaacaattggcagctgcgtgatgagtttgcggta
agaagcaatcaaacggagctggcgcagcgactctccaaactgatattgggggtggcgttg
ttaaatttggtcctagcgcctgtgatcttcgtatggcaacttatctacttcagtttctcc
tatgcgaacattcttcgtaaggagcctggtgcccttggcctgcgtacatggtccaattac
ggccgcctctacctgcgccactttaatgaactggaccacgaactagatgccaggctgaat
cgggcatatgactacgcggaccgctatctcaactccttttcctcgccactggccgctgtg
atagccaaaaacctactctttatcagtggaggactactacttctaatccttgcattgggc
atttacgaggaacacgtcttccaggtggagcatttgcttgccatccttgcagggctcggc
gccataggtgtggtctgcagaactctaataccggatgagaatctcgtttggtgcccagag
cagctaatgaccgccattctggcgcacgttcactacctgccctccgagtggcggcagcag
gcgcacacgacaaaggttcgccaggagtttagcaacttctttcagtttaaggctggctac
ctactcagcgaaatcttcagtcccttcgtcacacccttcgtgctgatctttgtgttcagg
ccaaaggccatagagctggtgcgtttcttcaggacgttcaccgtatccgtgcgaggagtg
ggcaacgtatgctcctttgcccagatggatgttcgcaagcatggcaatcccgactggcag
ttaaccagcgaactggaggagatgacccgggctacagctcaacagccgcagcaggagcca
cagcagcaaagtttggccggcggcaaaacggagatgtcgcttcttcgcttcaccctgaac
aatcccgagtggcagatgcccaaggaggccaagcagttcctgcgcggcgttagagagcac
gccgttggtgaactagtccaggccaagacgtcgatggtgcaggagaacccgctgaccaac
agcctcatctcatttggcaccatgggagcggattattgttccattgcgaactctgtgctg
accgcacaggtgacgccccagcaactggagatttcgcagtcgttgcgtccgggtctagga
ccggtatctggaggattccccgtcgcagccagcgacttccgccagatgttgcagcagaat
ctgtccgccagtgtcggcccgctggacagcatgcgccgattgcgcctcagccgggctgaa
ggccgcttggagggtccgacggatacactgctctacggactctgtggtgtggacccgcgc
gtgggcagcactcccttgaatgtgggcgtggccgacatgtgcctcagtgccctctatttg
cacgagctgaaccagcagaagcgccaagcgcgccagtctcgcatcgacgaggccgaggac
gagcgtcctggtacgagccattggccaccgcgaccaccagctgctccgtcggctgatact
ggcttcggctcccgccataccgtgattacctcaaaggctgccgagagcacgccgcttttg
ggtagcatccgctcatagcagcggccagagtggatctaa

DBGET integrated database retrieval system