KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3622
Entry
Dmel_CG3622       CDS       T00030                                 

Gene name
stl
Definition
(RefSeq) stall, isoform C
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: Reprolysin ADAM_CR_2 Reprolysin_5 Reprolysin_3 Reprolysin_2 Reprolysin_4 Peptidase_M10 Peptidase_M48 Peptidase_M57 DUF4953
Other DBs
NCBI-GeneID: 37619
NCBI-ProteinID: NP_001097423
FlyBase: FBgn0086408
UniProt: Q9W1Z6
Position
2R
AA seq 1136 aa
MTVAAIGSNRHRRLALIVLTTLWLLIGASSSSSSTSSTNPKSVNIELRRKRSLHYNGIEL
DKNTLVGHLREHERALIFGSRSPEEAPEFKLVHLAQQRPEEQQRLEERKRPGEAEQHGGN
PHQRRQRRSLPSEDGNGPLPPEEEEQEAGEDVEARLQLQQSPQLIDDAFIFIRRTENGTQ
FVEHSPQLLKRLERCFYRSPAAALDLCEPGNVRGVFQQNGSDLVIHPLPARFGTGTHVLY
QARVDKSGGGYSEASSRRTASPLDSQLQFEPDAEEFNEPRRRLRAQSQLQSPLRLRFQPR
HHHPHQHHQQRRRRYIGDAPRSRWSDIPEELFIETAIFVDSDLYAHMQKNFPTNTESKVV
SFLLAMINGVQLLYHHPTLGRRINFVLKRLEIWKSWDPPGLVRSRDVENYLNSFCKWQEK
LNPFSDADPLHYDHALVLTGLDLVTYDKGKANSQVVGMATVKGMCTSIYSCTINEAKHFE
SVFVVAHEIGHNLGMRHDAKEISCDPTMHIMSPKLGSGKVTWSKCSRTYLEDFLMDPQAE
CLFDRDSFAGPWDHTAGGRLPGERFNANQQCMLRFGKNFMQASTQSKMEICRDLHCRQDG
LPWTSHPALEGTECGPNMWCRGGTCEARSSKQGSYSALKSWPPEHIPEATHEKIIRHEPN
RIPPLLHDYNPMDNELPGSPSNWGEWSEPSACESGCLYGQSRRLLEGSTGLRTLNRSCLN
FPSRCIGRDRRFVTCNTPQCHKVPVQTINDFATQVCMQARKSDPELTGEGQQLPSTLDAS
CKIFCRTRTNGTKSRRWTFPDGTTCKAKQHNPEDITYCISGRCERFSCDNSTSNFFKMDS
SFCEARSVRPTRDSSDQESRQQTNRQRYAERQEGKPQKNHYENEVAKRPSYGQGNHINAP
ASPYKRRNYHKPYPPEIPRPPPPASASLIALDRSSSSESEWVAHPGCHSNCMTDSKGVQG
VTSRLTGVESIQLCSYRIQPCERLQTAAEYAEQTCARYRQKVRGLSGHGAQISASIDEPD
RSCRVGCQDEFIKYRYYLVNGRNGHFPPGTRCSPVGKRYCVYGRCLEFGDDDLPLDKTHI
SLGQLRTRRKRSSISNDLFNITEIFIKPSHSDISAENIEFTQPIHVSADELSSKSR
NT seq 3411 nt   +upstreamnt  +downstreamnt
atgactgtcgcagcaattggatctaatcggcaccgtcgtttggctttaattgttttgacc
accttgtggctgctaatcggggccagcagctcctcatcctccacctcctccaccaatcca
aaatccgtcaacattgagctgcgtcgcaagaggagcttgcactacaatggcattgagctg
gacaagaacaccctggtcggccatctgagggagcacgagcgggccctgatctttggatca
cgatctccggaagaggcgcccgaattcaaactcgtgcacttggcacaacaacgacctgag
gagcagcagcggctggaggagaggaagcggccaggtgaggcggagcagcatgggggcaat
cctcaccagagacgtcagcggcgcagcctgccatcagaagatgggaatgggccactgccg
ccggaggaggaggagcaggaggctggggaagatgtggaggcgcggttgcagctgcagcag
tcgccgcagctgatcgatgacgccttcattttcatccgacgcaccgagaacggcacccag
ttcgtggagcactcgccgcagctgctcaagcgcctggagagatgcttctatcggagtcca
gcggctgctctcgatctctgcgagcccggcaatgtgcgcggcgtgttccaacagaatggc
agtgacctggtgatccatccgcttcccgcgcgcttcggcactgggacgcacgtgctctac
caagcgagggtggacaagagcggcggcggctacagtgaggcgtcgtcaaggcgaacggcg
tcgccgttagacagccagctgcagttcgagcccgatgcggaggagttcaacgaaccgcgg
cggcgattgcgggcccagtctcagttacagtccccgttgagattgcgcttccagccacga
catcatcacccacatcagcaccatcagcagcgaagacgccgctacattggggatgcgccg
cgctcccgctggtcggatattcctgaggaactcttcattgagacggccatctttgtggac
agcgatctctatgctcacatgcagaagaacttccccacaaacacggagagcaaggtggtc
agtttcctgctggccatgatcaatggcgtccaactgctataccatcaccccactctgggt
cgtcgcatcaatttcgtgctgaagcgcctagagatctggaagtcctgggatccaccgggc
ctggttcgttccagggatgtggagaactacctgaacagcttctgcaagtggcaggagaaa
ctgaatcccttctccgacgcagatccgctgcactacgatcacgccctggttctgacaggt
ctcgacctcgtcacctacgacaagggcaaggccaatagccaggtggtgggcatggcgacg
gtcaagggcatgtgcacctctatctactcctgcaccatcaacgaggccaagcacttcgag
agcgtctttgtggtggctcacgaaattggacataatttgggaatgcgacacgatgccaag
gagattagctgcgatcctaccatgcacatcatgtccccgaagctgggcagcggcaaggtc
acctggtccaagtgctcgcgcacctatcttgaggatttcctaatggatccccaggcagag
tgcctcttcgatcgggactcgttcgcgggtccttgggatcatacggcaggtggtcgtctt
cctggcgaacgtttcaatgccaatcagcagtgcatgctgcgctttgggaagaacttcatg
caggctagcacccagagcaagatggaaatctgtcgggatctccactgtcgccaggatgga
ctgccctggacttcgcatccggcgctggagggaaccgaatgcggccccaacatgtggtgc
cgaggtggaacctgtgaggcacgttcctccaaacagggcagctactcagccctcaagtcc
tggcctcctgaacatattcccgaggccacccacgagaagattatccgacatgagccgaac
aggattcccccgctgctgcacgactacaatccgatggataatgagctgccaggatcgccc
tcgaattggggcgagtggagcgagccgagtgcctgtgagtccggctgcctctacgggcag
tcacgccgcctcctggagggcagcacaggtctccgaacgttgaacagaagctgcctgaac
tttccatcgcgctgcattggcagggatcggcgatttgtcacctgcaacacaccgcaatgc
cacaaggtgcccgtccagacaatcaacgactttgccacccaagtgtgcatgcaggcgagg
aagtcggatccggaactcaccggcgagggccagcagctgcccagcacgctggacgcgtcc
tgcaagatcttctgccgcaccaggaccaatggcaccaagtcccggcgctggacattcccg
gatggcaccacctgcaaagcgaagcagcacaaccccgaggatatcacctattgcatttcc
ggtcgctgtgagcgcttctcctgcgataattccacctccaacttcttcaagatggacagc
agtttctgcgaggcgagatcagtgcgccccacaagggattcctcggatcaggagagcaga
cagcagaccaacaggcagcgatatgcggagcgccaggagggaaaaccacagaagaatcac
tacgagaatgaggtagctaagcgaccttcgtatggccaaggcaaccacatcaatgcgcca
gcatcgccgtacaagaggaggaactatcacaagccatatcctccagagattccgcgtccc
ccaccgcctgcctctgcatcactgatcgcattggatcgcagctcgtcctcggaatcggag
tgggtggcccacccgggctgccactccaactgcatgacagactcgaagggcgtgcagggt
gtcacctcgcggctgaccggtgtggagagcatccaactgtgctcctatcgcattcaaccc
tgcgagcgtttgcagacggcggcggagtatgcggaacagacgtgtgccaggtatcgccag
aaggtgcgcggtctgtccggccacggggcacagatctcggctagcatcgatgagccggac
cgcagctgccgcgttggctgccaggatgagttcattaagtacaggtactacctggtgaat
ggccggaacggacactttccgccaggcactcgctgctcgccggtgggcaaacgatattgc
gtgtatggcaggtgcctggaattcggcgacgatgatctgccgctggacaagacccacatt
agcttgggtcaactgaggacgcgacggaaaaggagctcgatctccaatgatttgttcaac
ataacggagatattcattaaaccatcacattcagatatctccgccgaaaacatcgaattc
acccaacccattcacgtctccgcagacgaactgagtagcaaaagccgatag

DBGET integrated database retrieval system