KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3656
Entry
Dmel_CG3656       CDS       T00030                                 

Gene name
Cyp4d1
Definition
(RefSeq) cytochrome P450-4d1, isoform A
  KO
K15001  cytochrome P450 family 4 [EC:1.14.-.-]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:dme00199]
    Dmel_CG3656 (Cyp4d1)
Enzymes [BR:dme01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-  Acting on paired donors, with incorporation or reduction of molecular oxygen
    1.14.-.-  
     Dmel_CG3656 (Cyp4d1)
Cytochrome P450 [BR:dme00199]
 Cytochrome P450, animal type
  CYP4 family
   Dmel_CG3656 (Cyp4d1)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 31188
NCBI-ProteinID: NP_476907
FlyBase: FBgn0005670
UniProt: P33269 A0A0F6T2F9
Position
X
AA seq 512 aa
MFLVIGAILASALFVGLLLYHLKFKRLIDLISYMPGPPVLPLVGHGHHFIGKPPHEMVKK
IFEFMETYSKDQVLKVWLGPELNVLMGNPKDVEVVLGTLRFNDKAGEYKALEPWLKEGLL
VSRGRKWHKRRKIITPAFHFKILDQFVEVFEKGSRDLLRNMEQDRLKHGDSGFSLYDWIN
LCTMDTICETAMGVSINAQSNADSEYVQAVKTISMVLHKRMFNILYRFDLTYMLTPLARA
EKKALNVLHQFTEKIIVQRREELIREGSSQESSNDDADVGAKRKMAFLDILLQSTVDERP
LSNLDIREEVDTFMFEGHDTTSSALMFFFYNIATHPEAQKKCFEEIRSVVGNDKSTPVSY
ELLNQLHYVDLCVKETLRMYPSVPLLGRKVLEDCEINGKLIPAGTNIGISPLYLGRREEL
FSEPNIFKPERFDVVTTAEKLNPYAYIPFSAGPRNCIGQKFAMLEIKAIVANVLRHYEVD
FVGDSSEPPVLIAELILRTKEPLMFKVRERVY
NT seq 1539 nt   +upstreamnt  +downstreamnt
atgtttctggtcatcggcgcaatcctggccagcgccctcttcgtgggcctgctgctctac
catctaaaattcaagcggctgattgacctcatcagctacatgccgggtcctcccgtgctg
ccgctggtcggccatggccaccacttcatcggcaagccgccgcacgagatggtcaagaag
attttcgagttcatggagacctactccaaggaccaggtgctcaaggtgtggctgggaccc
gagctgaacgtgctcatgggcaaccccaaggacgtcgaggtcgtcctgggcacgttgcgc
ttcaacgacaaggcgggtgaatacaaggccctggagccgtggctaaaggagggtctgctg
gtcagtcgcggtcggaagtggcacaagcgacgcaaaattatcacgcccgccttccacttc
aagatcctcgaccagttcgttgaggtcttcgagaaggggtcgcgagatttgctccggaat
atggagcaggatcgcctgaagcacggcgactccggctttagcctctacgactggatcaat
ctctgcaccatggacacgatctgcgaaactgccatgggtgtttccatcaatgcgcagtcg
aatgcagactccgagtacgtccaggcggtgaagaccatatcaatggtgctgcacaagcgg
atgttcaacattctgtaccgcttcgaccttacctacatgctgaccccactggcgagggcg
gagaagaaggccctgaacgtgcttcaccagttcacagagaagatcatcgtgcagcgcagg
gaggagctcatccgcgaaggaagcagccaggagagcagcaatgatgacgcggacgtgggc
gccaagcgaaagatggccttcctggacatccttctgcagtcgaccgtcgacgaacggccc
ctgagcaacttggacattcgcgaggaagtggacaccttcatgttcgagggccacgacacc
acctcttcggccctgatgttcttcttctacaacatagccacccacccggaggcgcagaag
aagtgctttgaggagatccggtccgtggtgggcaatgacaagagcacgccggtgagctat
gagctgctgaaccagctgcactacgtcgacctgtgcgtgaaggagacccttcgaatgtat
ccgtctgtaccgctgctgggtcgtaaggttctcgaggactgcgagatcaatggaaagctc
atcccggcgggcacgaatatcggcatctcccctctctacttgggcagacgggaggagctc
tttagcgagcccaatatcttcaagccggaacggttcgatgtggtcaccaccgccgagaag
ctgaatccgtacgcgtacattccgttctcggccggacctcgcaactgcattggccagaag
ttcgccatgctggagatcaaggccatcgtggccaatgtgctccggcactacgaggttgac
tttgtgggcgactcctcggaaccacccgtgctgatcgccgaacttattctgcgtaccaag
gaacccttgatgttcaaggtgcgggagcgagtctactga

DBGET integrated database retrieval system