KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3664
Entry
Dmel_CG3664       CDS       T00030                                 

Symbol
Rab5
Name
(RefSeq) Rab5, isoform G
  KO
K07889  Ras-related protein Rab-5C
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04144  Endocytosis
dme04145  Phagosome
Brite
KEGG Orthology (KO) [BR:dme00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    Dmel_CG3664 (Rab5)
   04145 Phagosome
    Dmel_CG3664 (Rab5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dme04131]
    Dmel_CG3664 (Rab5)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dme04147]
    Dmel_CG3664 (Rab5)
   04031 GTP-binding proteins [BR:dme04031]
    Dmel_CG3664 (Rab5)
Membrane trafficking [BR:dme04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab GTPases
    Dmel_CG3664 (Rab5)
 Endosome - Lysosome transport
    Dmel_CG3664 (Rab5)
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dmel_CG3664 (Rab5)
  Exosomal proteins of other body fluids (saliva and urine)
   Dmel_CG3664 (Rab5)
  Exosomal proteins of colorectal cancer cells
   Dmel_CG3664 (Rab5)
  Exosomal proteins of bladder cancer cells
   Dmel_CG3664 (Rab5)
GTP-binding proteins [BR:dme04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab5/17/22/31 [OT]
    Dmel_CG3664 (Rab5)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA RsgA_GTPase GTP_EFTU AAA_16 G-alpha
Other DBs
NCBI-GeneID: 33418
NCBI-ProteinID: NP_001259925
FlyBase: FBgn0014010
UniProt: Q9V3I2
Position
2L
AA seq 219 aa
MATTPRSGGASGTGTAQRPNGTSQNKSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQES
TIGAAFLTQTICIEDTVVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRA
KTWVKELHKQASPNIVIALAGNKADLSNIRVVEFDEAKQYAEENGLLFMETSAKTGMNVN
DIFLAIAKKLPKNDGANNQGTSIRPTGTETNRPTNNCCK
NT seq 660 nt   +upstreamnt  +downstreamnt
atggcaaccactccacgcagcggcggtgccagcggcactggaacggcgcagcggcccaat
ggcacctcgcagaacaaaagctgccaattcaagttggtgctcctcggcgagtccgctgtg
ggcaagtcctcactggtgctgcgcttcgtcaagggacagttccacgagtaccaggagagc
acgataggtgcggcctttctgacacagactatttgcatagaggacactgtcgttaagttc
gagatctgggacacggctggccaggagcggtaccacagcttagctcccatgtattatcga
ggagcgcaggccgctattgtcgtctatgatatacagaatcaggacagttttcagcgtgcg
aagacctgggtcaaggaactgcataaacaagcctcaccaaacattgtcattgcgctggcc
ggcaacaaggcagatttgtcaaacattcgcgtcgtagagttcgatgaagcgaagcaatat
gccgaggagaacgggctgctgttcatggaaacctccgccaagacgggcatgaatgtgaac
gacatcttcttggccattgccaagaaactacctaagaacgatggcgccaacaatcaggga
accagcataaggccgactggaaccgaaacaaatcgaccgacgaacaactgctgcaagtga

DBGET integrated database retrieval system