KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3725
Entry
Dmel_CG3725       CDS       T00030                                 
Symbol
SERCA
Name
(RefSeq) Sarco/endoplasmic reticulum Ca(2+)-ATPase, isoform B
  KO
K05853  P-type Ca2+ transporter type 2A [EC:7.2.2.10]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04148  Efferocytosis
Brite
KEGG Orthology (KO) [BR:dme00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04148 Efferocytosis
    Dmel_CG3725 (SERCA)
Enzymes [BR:dme01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     Dmel_CG3725 (SERCA)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Cation_ATPase_N Hydrolase HAD Hydrolase_3
Other DBs
NCBI-GeneID: 49297
NCBI-ProteinID: NP_726381
FlyBase: FBgn0263006
UniProt: P22700 E8NHA8
Position
2R
AA seq 1020 aa
MEDGHSKTVEQSLNFFGTDPERGLTLDQIKANQKKYGPNELPTEEGKSIWQLVLEQFDDL
LVKILLLAAIISFVLALFEEHEETFTAFVEPLVILLILIANAVVGVWQERNAESAIEALK
EYEPEMGKVVRQDKSGIQKVRAKEIVPGDLVEVSVGDKIPADIRITHIYSTTLRIDQSIL
TGESVSVIKHTDAIPDPRAVNQDKKNILFSGTNVAAGKARGVVIGTGLSTAIGKIRTEMS
ETEEIKTPLQQKLDEFGEQLSKVISVICVAVWAINIGHFNDPAHGGSWIKGAIYYFKIAV
ALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQ
MSVSRMFIFDKVEGNDSSFLEFEMTGSTYEPIGEVFLNGQRIKAADYDTLQELSTICIMC
NDSAIDYNEFKQAFEKVGEATETALIVLAEKLNSFSVNKSGLDRRSAAIACRGEIETKWK
KEFTLEFSRDRKSMSSYCTPLKASRLGTGPKLFVKGAPEGVLERCTHARVGTTKVPLTSA
LKAKILALTGQYGTGRDTLRCLALAVADSPMKPDEMDLGDSTKFYQYEVNLTFVGVVGML
DPPRKEVFDSIVRCRAAGIRVIVITGDNKATAEAICRRIGVFAEDEDTTGKSYSGREFDD
LSPTEQKAAVARSRLFSRVEPQHKSKIVEFLQSMNEISAMTGDGVNDAPALKKAEIGIAM
GSGTAVAKSAAEMVLADDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAA
LGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMEKPPRKADEGLISGWLFFRYMAI
GFYVGAATVGAAAWWFVFSDEGPKLSYWQLTHHLSCLGGGDEFKGVDCKIFSDPHAMTMA
LSVLVTIEMLNAMNSLSENQSLITMPPWCNLWLIGSMALSFTLHFVILYVDVLSTVFQVT
PLSAEEWITVMKFSIPVVLLDETLKFVARKIADGESPIYKMHGIVLMWAVFFGLLYAMML
NT seq 3063 nt   +upstreamnt  +downstreamnt
atggaagacggtcactcgaaaaccgtcgaacagtccctcaacttcttcggaacggacccc
gagcgcggcttaaccctcgaccagatcaaggctaaccagaagaaatacggacccaatgag
ttgccgactgaggaaggaaagagcatctggcagctggtcttggagcagttcgacgatctg
ctggtgaagattctgctgttggcagccatcatctcatttgttctcgccctgtttgaggaa
cacgaggaaacgttcactgcatttgtagagcccctagttattttacttatcctgatagcc
aacgccgtggtgggagtatggcaggagcgtaacgccgagtcggccattgaggccctcaag
gagtacgagcctgagatgggcaaggtggtgcgccaggacaagtccggcatccagaaggtg
cgcgcgaaagagatcgtgcccggtgacctggttgaggtgtctgtcggtgacaagatccct
gccgatatccgtatcacccacatctactcgaccacccttaggatcgatcagtccatcctc
accggtgagtcggtctccgtcatcaagcacaccgatgccatccccgatccccgcgccgtc
aaccaggacaagaagaacatcctgttctccggcaccaacgtcgcagccggcaaggcccgt
ggcgtcgtcatcggcactggcctgagcaccgccatcggcaagatccgtactgagatgtcc
gagaccgaggagatcaagacccccctgcagcagaaactggacgagttcggtgagcagctg
tccaaggtcatttccgtcatttgcgttgccgtgtgggccatcaacatcggccacttcaac
gaccccgctcacggaggctcctggatcaagggtgccatctactacttcaagatcgccgtc
gctctggctgtggctgccatccccgagggtctgcccgccgtcatcaccacctgtctggct
ctgggcacccgccgcatggccaagaagaatgccatcgtccgctccctgccctccgtggag
accctgggctgcacatctgtcatctgctctgataagaccggcacactcaccaccaaccaa
atgtccgtttcccgcatgttcatcttcgacaaggttgaaggcaacgacagcagcttcctc
gaattcgagatgaccggctccacctacgagcccatcggcgaggtcttcctcaacggtcag
cgcatcaaggctgctgactacgataccctgcaggaactgtccaccatctgcatcatgtgc
aacgactccgccattgattacaatgagttcaagcaggccttcgagaaggtcggcgaagcc
actgagaccgccctgattgtgctggctgagaaactgaacagcttcagcgtgaacaagtct
ggcctggaccgccgctcggctgccatcgcctgccgcggtgagatcgaaaccaagtggaag
aaggaattcaccctggagttctctcgcgatcgtaaatccatgtcctcgtactgcaccccc
ctgaaggcttcccgcctgggcactggccccaagttgttcgtgaagggcgcccccgagggt
gttctagagcgttgcacacacgcccgcgttggcaccaccaaggttcctctgacctcggcc
ctgaaggccaagatcctcgccctgaccggccagtacggtactggacgcgacacccttcgc
tgcctggctctggccgttgccgatagccccatgaagcccgacgagatggatctgggcgac
tccaccaagttctaccagtatgaggttaacctgaccttcgtcggtgttgtgggcatgttg
gatcccccccgtaaggaagttttcgattccattgtccgctgccgtgccgccggtattcgt
gttattgtgatcaccggcgacaacaaggccactgccgaggctatctgccgcagaatcggt
gtattcgccgaggatgaggacaccactggcaagtcctactcgggtcgtgaattcgacgac
ctttcccccaccgaacaaaaggctgccgtcgcccgctcccgcctcttctcccgcgtggag
ccccagcacaagtccaagattgttgagttcctgcagagcatgaacgaaatctccgctatg
actggtgatggtgtgaacgacgcccccgccctgaagaaggctgagatcggtattgccatg
ggctctggtaccgccgtcgccaagtctgccgccgaaatggtgctggctgacgacaacttc
tcctccatcgtgtctgccgttgaagaaggtcgcgctatctacaacaacatgaaacagttc
atccgctacctcatctcttcgaacattggtgaggtcgtctccatcttccttactgctgcc
cttggcctgcccgaggctctgattcccgtccagctgctctgggttaacttggttactgat
ggtctcccagccaccgctctgggcttcaacccccctgatctggatatcatggagaagccc
cccaggaaggccgatgagggtctcatttccggatggttgttcttccgttacatggctatt
ggattctatgtcggcgctgccaccgtcggtgccgccgcctggtggttcgtgttctctgat
gagggacccaaactgtcctactggcagctgacccaccatctgtcctgcttgggcggtggc
gacgagttcaagggcgttgactgcaagatcttcagcgacccccatgcgatgaccatggct
ctgtccgtgctggtgacaatcgaaatgttgaacgcaatgaacagcttgtccgagaaccag
tcgctgattaccatgcccccatggtgcaacctgtggctgattggatcaatggcactctcc
ttcactcttcactttgttattctttacgtcgatgtcctctccaccgtcttccaagtgaca
ccgttgtctgcagaagaatggataactgtgatgaaattctcaattcctgtagttttatta
gatgagacattgaagtttgttgctagaaaaatcgcagatggtgagagtcctatatataag
atgcatgggattgtgttaatgtgggctgtcttctttggcctgctgtacgctatgatgctt
taa

DBGET integrated database retrieval system