KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3730
Entry
Dmel_CG3730       CDS       T00030                                 

Gene name
csul
Definition
(RefSeq) capsuleen, isoform A
  KO
K02516  type II protein arginine methyltransferase [EC:2.1.1.320]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme03013  RNA transport
Brite
KEGG Orthology (KO) [BR:dme00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    Dmel_CG3730 (csul)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dme03041]
    Dmel_CG3730 (csul)
   03036 Chromosome and associated proteins [BR:dme03036]
    Dmel_CG3730 (csul)
Enzymes [BR:dme01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.320  type II protein arginine methyltransferase
     Dmel_CG3730 (csul)
Spliceosome [BR:dme03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    Dmel_CG3730 (csul)
Chromosome and associated proteins [BR:dme03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    PRMTs (protein arginine metyltransferases)
     Dmel_CG3730 (csul)
SSDB
Motif
Pfam: PRMT5 PRMT5_TIM PRMT5_C Met_10 DUF1772
Other DBs
NCBI-GeneID: 36809
NCBI-ProteinID: NP_477184
FlyBase: FBgn0015925
UniProt: Q9U6Y9
Position
2R
AA seq 610 aa
MNYYVCLHQEGVNSIPKLIEKAFANNYNVVSTSINANMLPFEPHESDPTYPATILSGSDW
NSKVIFTMSDVNVDSPNDKLREHAKEVFMRDVAWAEHLQNVGNLMVRLRGPENENLASIV
LAKTKDDFPSGNWFIQVPITNPELATFEHRKDATAEEVAEAESNDPWNWWNNLRMVTKHS
TKVKVVIELNDADRPSKETVRRWLGEPIEAIIIPSSLFVRNRSNYCVLKKEWQLIVGHFI
SVRANIIISTNPNDKALCQYADYVNKLINDNCDKHMLNSYENMLEIPLQPLCDNLDTYTY
EVFETDPVKYKLYQDAVQAALLDRVSAAEAKTKLTVVMLLGGGRGPLARAVFNAAELTKR
KVRLYIIEKNPNAIRTLSNMVKTLWADKDVHIFSKDMRDFSPPELADIMVSELLGSFGDN
ELSPECLDGALKLLKPDGISIPYKSTSYINPLMSAVLHQNVCQLLPTYPAFDYGYVSLLK
NIYHIDEPQALFEFVHPNRAENIDNTRCKTVSFKVNKDCVLHGIGGYFDTHLYKDICLSI
NPLTHTPGMFSWFPMFFATRPRTLREGQTISIQFWRCVDATKVWYEWQVVNSPDDWEHHN
TRGTGYNMRL
NT seq 1833 nt   +upstreamnt  +downstreamnt
atgaattactacgtctgtctgcaccaggagggtgttaatagcatacccaagttaatcgag
aaggccttcgcgaacaactataatgtggtttccacctctatcaacgccaatatgttgccc
ttcgaaccacacgaatcggatcccacatatccggccacaattttgagcggcagcgactgg
aattccaaggtgatatttaccatgtccgacgtgaatgtggactcgccgaatgacaagctg
cgcgaacacgcaaaggaggtattcatgagggacgtggcctgggcggagcacctgcaaaat
gtgggcaacctgatggtacggctgcgcggtccggaaaacgagaatctggcctccattgtg
ctggccaaaacaaaggatgattttccttcagggaactggttcatccaagtgcccatcacc
aatccagaactggccacattcgagcaccgaaaggatgccaccgccgaggaggtggctgaa
gcggaatcgaatgacccgtggaactggtggaataacctgcgcatggtcaccaaacacagc
accaaagtgaaggttgtgatagagctaaacgatgctgatcgacccagcaaggaaacagtg
cgtcgctggttgggcgaaccaatcgaggcaatcatcattccgtcttccctgttcgtcaga
aaccgctccaactactgtgtgctgaagaaggagtggcagctcatcgtcgggcacttcatc
tcggtacgggccaacatcatcatctccacaaatcccaacgataaggctttgtgccagtac
gcggattacgtaaataagctaattaatgataactgcgataagcacatgctaaacagctat
gaaaacatgctggaaattccactgcagcctctttgcgataatctggacacctatacctat
gaggtattcgaaactgatcctgtcaaatacaaactctatcaggatgccgtacaagcggcc
ctgttggatcgagtaagcgctgcggaggctaaaacgaaactgacagttgtaatgctactg
ggtggaggacgaggtcctttagcgagagctgttttcaatgctgccgagttaacgaagcgc
aaagttcgcctctacatcatagaaaagaatcccaatgccatccgcaccctctccaacatg
gttaaaacgctttgggccgataaggatgttcacattttttcaaaggacatgcgggacttt
tcccctccagagctggctgacatcatggtttcggagttacttggttcctttggcgataat
gaactttcgcccgagtgccttgatggagcactgaagctgctcaaaccggatggaatcagt
ataccctacaaatccacctcctacattaatccactgatgtcagcagtgctgcaccaaaat
gtctgccaattgttaccaacctatcctgccttcgactacggctatgtgtcgctgctaaag
aatatttaccatattgacgagccgcaggctctgtttgaattcgtacatcctaatcgagcg
gaaaatattgacaatactcgctgcaagacggtttcatttaaagtcaataaagattgcgtg
ctgcacggaatcggcggatactttgatacccatttgtacaaggacatctgcctaagcatc
aatcctctgacccatacgcctggcatgttctcctggttccccatgttcttcgcaacgcgt
ccaagaactctgagggagggacagactatatccatccagttttggcgatgcgtggatgca
accaaagtgtggtacgaatggcaggtggtcaattctccagacgattgggagcaccataac
acacgcgggacaggttacaacatgcgattgtaa

DBGET integrated database retrieval system