KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3776
Entry
Dmel_CG3776       CDS       T00030                                 

Gene name
CG3776
Definition
(RefSeq) uncharacterized protein, isoform B
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: Tim44
Other DBs
NCBI-GeneID: 37996
NCBI-ProteinID: NP_001286868
FlyBase: FBgn0035088
UniProt: Q9W0X3
Position
2R
AA seq 263 aa
MQHTLIRCLGMARISLMRLQPRPTVAASGGQEAGSISKPTQPVSRSFASLPQEQDKKEQN
ARESLNRLPRLMDFPEIVWPSALNSLKNWITIQFIIRPYFDSEFQLKDFIYGAKQALQVV
SSKLMGGDLDSLDNLVSPEAIAELRPVIQKLSMTQRRQLEIKESDIYLSFPYQVGIMFDD
ANDKLQKRFVEITMVFHVMRGLSEMRERGEEIPWNMGTLPEYQDKVFICNYRFVKEFTAG
HQSDWTVNVANQFRAIDLINETI
NT seq 792 nt   +upstreamnt  +downstreamnt
atgcagcacacgcttatacgctgcttgggcatggcccggatatccctgatgcgtttgcag
cccagacccacagtggcagcctccgggggacaggaagctgggtccatctcgaagccaaca
caaccggtcagtcggtctttcgcctcgctgccgcaggagcaagacaagaaggagcagaat
gccagagagagccttaaccgcctgcctcgcctaatggactttccagagatcgtgtggcca
tcggcgcttaactcgttaaaaaattggatcaccatacagttcataattcgaccctacttc
gacagcgagtttcaactcaaggacttcatatacggcgccaagcaagcgctgcaggtagta
tcctcaaaactgatgggcggcgacttagactccctggacaatcttgtctcgcccgaggcg
atcgcagagcttagaccggtaatccaaaaactgtcaatgacgcaacggaggcagctagaa
atcaaggagagcgacatatacctcagctttccctatcaggtaggtattatgtttgacgat
gcaaacgacaagctgcagaagcgtttcgtagagatcaccatggtgtttcacgtaatgcgt
ggtctatccgagatgcgggaacgcggcgaggaaataccctggaacatggggacccttccc
gagtaccaggataaggttttcatctgcaactaccgttttgtaaaggagttcaccgctgga
caccaatcggactggaccgtaaatgtggccaaccagtttagggccatcgaccttattaac
gagaccatataa

DBGET integrated database retrieval system