KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3938
Entry
Dmel_CG3938       CDS       T00030                                 

Gene name
CycE
Definition
(RefSeq) cyclin E, isoform A
  KO
K06626  G1/S-specific cyclin-E1
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04391 Hippo signaling pathway - fly
    Dmel_CG3938 (CycE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:dme03032]
    Dmel_CG3938 (CycE)
   03036 Chromosome and associated proteins [BR:dme03036]
    Dmel_CG3938 (CycE)
DNA replication proteins [BR:dme03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    Dmel_CG3938 (CycE)
Chromosome and associated proteins [BR:dme03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    Dmel_CG3938 (CycE)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 34924
NCBI-ProteinID: NP_476959
FlyBase: FBgn0010382
UniProt: P54733 A4V0R4
Position
2L
AA seq 709 aa
MGLNAKSVCSTSSTEPNGSIVTTAPSNGEVSSSIVVVVSSSSISSSSDSPIAILPHPDPI
PSTSFSSASQRSEEELPGTSAASRTDEMCSCDSQNLAASTAATSNGNKRKRRLSSDSNED
PELGFEPPSAKRQQRLPALYGSEQGNLSSVASSVYTSPVVSVDGQSTQELLSIRSSPAED
LSEAPHSPLPDSPDSPPSPDRGSKQTPVVVRYAAEQVVTSTVVTQKTEDDDLLDDSCEDY
SYDEDDEDDVEEEDDDVEIYSSTISPASSGCSQQQAVNGERTPGLPKHQEQIHHPVSDLM
INMRTPMSPAVENGLRQCPLPALAWANAADVWRLMCHRDEQDSRLRSISMLEQHPGLQPR
MRAILLDWLIEVCEVYKLHRETFYLAVDYLDRYLHVAHKVQKTHLQLIGITCLFVAAKVE
EIYPPKIGEFAYVTDGACTERDILNHEKILLQALDWDISPITITGWLGVYMQLNVNNRTP
ASFSQIGRQKSAEADDAFIYPQFSGFEFVQTSQLLDLCTLDVGMANYSYSVLAAAAISHT
FSREMALRCSGLDWQVIQPCARWMEPFFRVISQKAPYLQLNEQNEQVSNKFGLGLICPNI
VTDDSHIIQTHTTTMDMYDEVLMAQDAAHAMRARIQASPATALRAPESLLTPPASSHKPD
EYLGDEGDETGARSGISSTTTCCNTAASNKGGKSSSNNSVTSCSSRSNP
NT seq 2130 nt   +upstreamnt  +downstreamnt
atgggtttaaatgccaagagtgtttgttctaccagcagcactgagccaaatggcagcata
gtcacaaccgcccccagcaacggagaagtgagcagcagcatagtcgtcgtcgtcagcagc
agtagtatcagtagcagcagcgatagcccaatcgctatccttccacatccagatccaatc
ccatcaacatcgttctcttcagcgtcgcaacgaagtgaagaggagctaccaggaacctca
gcagcctccagaaccgacgagatgtgctcttgtgatagccagaatcttgcagcatccaca
gccgcgacttccaatggcaataaacgtaaacggcgtttaagcagcgattcaaacgaggac
cctgaactcggttttgagcctccatcagctaagcgccagcagcgactgcccgctttgtac
ggcagcgagcagggcaatctgtcatcggttgcctcctcggtctacacctcgcccgttgtc
tcggttgatggccagagtacccaggagctgctcagcatacgtagctcaccggccgaggat
ctgtcggaggcgccacacagtccgctgccggacagcccggacagtccgccgagtccggat
cgtggaagcaagcagacgccagtggtggtgcgctacgctgcggagcaggtggtgaccagt
acggtggtcacgcagaagacggaggatgatgaccttttggacgacagctgcgaggactac
tcgtacgacgaggatgatgaggatgacgttgaggaggaggacgacgacgtggagatctac
tcctccacaatttctccagcctcctccggctgcagccagcagcaggcggtgaatggagag
cgtactcccggcctgccaaaacatcaggagcagatccatcatccggtcagtgacctgatg
attaacatgcggacgcccatgtcgccggctgtggagaacggtctgcgccagtgcccactt
cctgcgctcgcctgggctaacgccgccgatgtttggcgcctgatgtgtcaccgggatgag
caggactcgcgtctgcgcagcatttcgatgctggaacagcatcccggactgcaaccacgt
atgcgtgccattctcttggactggttgatcgaggtctgtgaagtttacaagctgcatcgg
gagaccttctacttggccgtcgactacctggatcgctatttgcatgtggcgcataaggtg
cagaagacgcacttgcagttgatcggcatcacctgcctgtttgtggccgccaaggtagag
gagatttatccgccaaagatcggggagtttgcttatgtgacggatggcgcctgcacagag
cgggacatccttaaccacgagaagattctgctgcaggcgctcgactgggacatcagcccc
atcaccattaccggctggctgggcgtctatatgcaactgaatgtgaacaaccgcactccg
gcctcgttctcccagattggcaggcaaaagagcgcggaggcggacgatgcctttatctac
ccgcaattctctggctttgagtttgtgcaaacctcacagctgctagatctgtgcaccctg
gacgtgggcatggccaactattcctactcggtgctggcagcggccgccatcagtcataca
tttagtcgggagatggctttacgctgttctggtctggattggcaggtgattcagccttgt
gctcgctggatggagccattcttccgagtgatctcccagaaggccccctacctgcagctg
aacgagcagaatgagcaagtcagcaacaaatttggcctgggactaatctgccccaatatt
gtcaccgacgactcgcacattatccaaacgcacacaactaccatggatatgtatgacgaa
gtgcttatggcccaggatgcggcgcatgccatgcgcgctaggattcaagcttccccggcc
accgcgctgcgcgctcccgaaagtcttctgacgcctcccgcctctagtcacaagccggac
gagtacctgggcgatgagggcgatgagacgggggccaggagcggcatctcctccacaacc
acatgctgcaacactgccgccagtaacaagggcggcaagagcagcagcaacaattcggtg
accagctgcagcagtagaagcaatccctga

DBGET integrated database retrieval system