KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3941
Entry
Dmel_CG3941       CDS       T00030                                 

Gene name
pita
Definition
(RefSeq) pita, isoform A
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-AD zf-Di19 zf-C2H2_jaz zf_C2H2_ZHX BolA zf-C2HC_2 DUF2256 zf-C2H2_9
Other DBs
NCBI-GeneID: 37730
NCBI-ProteinID: NP_611806
FlyBase: FBgn0034878
UniProt: Q95RQ8
Position
2R
AA seq 683 aa
MAAKLEVREAMLTEKRVCRFCLTEQKLASIFEENPRVKTTANLPLQIMAITAIEVYAGDG
MPGHICLECRLLFEHCYRFKQMCKRAETLLRQYPLTGNWPSPLEKPRAPMTMVASKKLLV
VPAKTAEPSETPKKLLNTMAKSSSQVIIEDVQVLESAMVTPRTVAGSSPVPRRSHAYELK
VDNNQELSMDDVQSMLEDMASELEKEFPDIPQKASPVKPKVLNKSSIRILNKGPAAPVEP
RLATPKVKRDDSGNVAIVTEVLDSDLPLDDQDDPTKNAEKVATDVFPCPDCERSFPLQQL
LEIHRLNHTRSRSFQCLLCEKSFFSKYDLAKHNFVHTGERPFKCAICSKAFTRKALLHRH
ERTHTDVPKFICVYCEKPFLSRQEMEKHAERHQKKRPFQCGVCTKSFAFKQGLERHETVH
STNLPFPCQHCERSFSTASKLARHLVAHAGKRAYPCKYCHKSYMLSHHLSRHLRTHTQTS
DASFVCSECKVSYSNYNDLLDHALIHATASLKCPMCRKQIEDIDSVESHMDQHKQSERHA
CEFCDHIFLTQKCLQRHIEDDHVVEMEPYQNEFEDDGEGEGGVDEKEEHLDDFEDMDNVK
QEEFVTEYLEDDALYEDHLDDSDESFTPPPPKQRKTNPPKDAQQSVRQTRSRDAQRITQK
TGKNEGKPHHKLERNLKNRRSAK
NT seq 2052 nt   +upstreamnt  +downstreamnt
atggccgcgaaactggaggtgcgcgaggccatgctgaccgagaagagggtctgccgcttc
tgtctgaccgagcagaagctggcctcgattttcgaggagaatccgcgggtgaaaacaacc
gccaatctgccgctgcagattatggccatcacggcgatcgaggtctacgccggcgacgga
atgccggggcacatctgtctggagtgccgcctcctcttcgagcactgctaccgcttcaag
cagatgtgcaagcgggcggagaccctcctgcgccagtatccgctcacgggtaactggcca
tcgccgctggagaagccccgtgcgcccatgacgatggtggcttccaagaagttgttggtc
gtgccagcaaagacagccgagccaagcgaaacgcccaaaaagctgctgaacacaatggcc
aaatccagtagtcaggtgatcatcgaggacgtccaggtgctggagagcgccatggtgacc
cccaggacggtagccggttcctctccagtgccacgtcgttcgcacgcctatgagctgaag
gtggataacaaccaggagctgtccatggacgatgtgcagagcatgctggaggatatggcc
agtgagctagagaaggagttccccgatatcccccagaaggcatcacccgtcaagccgaag
gtgctgaacaagtcctcgattaggatcttgaacaagggacccgccgctccggtggaaccg
cgcctggccacacccaaagtcaagcgagatgatagtggcaatgtggccatagtgacagag
gttctggactcggatctgccattggacgatcaagatgatccgaccaagaacgccgagaag
gtggccaccgatgtgttcccctgtcccgattgcgaacgctcctttccgctgcagcagctg
ctcgagatccatcggctgaatcacactcgctcgcgcagcttccagtgtctcctgtgcgag
aagagcttcttctccaagtacgacctggccaagcacaactttgtgcacaccggcgagcgg
ccattcaagtgcgccatctgctcgaaagccttcacacggaaggcattgctccatcgccac
gagcgcacccacacggacgtacccaagttcatctgcgtgtactgcgagaagcccttcctt
tcgcgccaggagatggagaagcacgccgagcgacatcagaagaagcgtccgttccaatgc
ggtgtctgcaccaagtcgtttgccttcaagcagggattggagcgtcatgagacagtccac
tccaccaatcttcccttcccctgtcagcattgcgagagaagcttttccaccgcttccaag
ctggcccgccacctggttgcccacgccgggaagagagcctatccctgcaagtactgccac
aagtcctacatgctgtcgcatcatctctcgcgccacctgcgcacgcacacgcagacttcc
gacgcctcgttcgtgtgcagtgagtgcaaggtgtcgtacagcaactataacgacctactg
gatcatgcgctcattcatgccaccgccagcctgaaatgtcccatgtgtcgcaagcagatc
gaagatatcgacagtgtcgagagccacatggaccagcacaagcagagcgagcgccatgcc
tgcgagttctgtgaccacatcttcttgacgcagaaatgcctgcagcgccacatcgaggac
gatcatgtggtggaaatggagccgtaccagaacgagttcgaagacgacggcgaaggagaa
ggcggcgtcgatgagaaggaggaacatcttgacgattttgaagacatggacaatgtgaag
caggaagaattcgtgacggaatacttagaagacgatgctctctatgaggaccacctagac
gatagcgacgaatccttcacgccgccgcctccaaagcagcgtaaaaccaatcctcccaag
gatgcccagcaatccgtgcgccaaactcgcagtcgggatgctcaaagaatcactcagaag
acaggaaagaacgaaggcaagcctcatcacaaactggaacgcaaccttaagaatcgccga
tccgcaaaataa

DBGET integrated database retrieval system