KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3945
Entry
Dmel_CG3945       CDS       T00030                                 

Gene name
Rad9
Definition
(RefSeq) Rad9, isoform B
  KO
K10994  cell cycle checkpoint control protein RAD9A [EC:3.1.11.2]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dme03400]
    Dmel_CG3945 (Rad9)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.2  exodeoxyribonuclease III
     Dmel_CG3945 (Rad9)
DNA repair and recombination proteins [BR:dme03400]
 Eukaryotic type
  Check point factors
   Rad9-Hus1-Rad1 complex
    Dmel_CG3945 (Rad9)
SSDB
Motif
Pfam: Rad9
Other DBs
NCBI-GeneID: 40054
NCBI-ProteinID: NP_001097639
FlyBase: FBgn0025807
UniProt: A8JNV5
Position
3L
AA seq 456 aa
MKYTLEGSNARVIAKAVQSLSKVGKEMFIEIDQQSLQMRAINATQSAVGSISFKRSMFEV
YDMPPHSDFYCKISMKGCLAVFRNMNEVEYCELNLLDNQTNLQVNLRCKLETTKEATISI
IDDQNINTNINTDQMPNIIRGDHKLLTDISNNFNSSEEELTLEANSGSVVAKNYIEGARV
NDKFMRTQLKLKPSEFEQYQVTKETVITFCIKEFRAFLLFAECLNASLTLEFDEAGMPFL
LKIKKHGEIECLLIMSTLSPDDISFSEDYCQKDLTVQDEDVRAAAAKRKSSVSKPNVTNK
RKGSSSEPAAVQPKRRVEETQLESSLDNPLFQFRDSEAPSVQHPRILAEVDTVVLIEDEA
EQEALMLAAADAALEASMAPAPEPPNSTEVCFINTDDSQQPKPAKSSSDEDETIPQSPER
PNKVRTIFSRCFQRTYVPREPSPNTQVYAPNSDTED
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgaaatacactttagagggcagcaatgcaagagtcatcgccaaagccgtacaatcgctg
tccaaggtgggcaaggagatgttcatcgagatcgaccagcaatccttgcagatgcgggcc
ataaatgccacccaatccgcagtgggcagcatatcgttcaaaagatccatgttcgaagtg
tatgacatgccgccgcactcagatttctactgcaagatctccatgaagggatgtttggcc
gtgttccgcaacatgaatgaggtggagtactgtgaactcaacttgctggacaaccagacc
aacctgcaggtgaatctccgctgtaagctggagaccacaaaggaggccaccatttccatc
atagacgaccaaaacattaacacaaacattaacaccgatcagatgccgaatataatccgt
ggcgatcacaagctgttgacggatatatccaataactttaactcctcagaggaggaactt
actttggaggcaaactcgggcagtgtggtggccaaaaactacatagaaggagcccgagtt
aatgataagttcatgcgcacgcagctgaaacttaagcccagtgaatttgagcagtaccag
gtaacgaaggagacggtcattacattctgcattaaggaattccgagcatttctcctcttc
gccgagtgcttaaatgcttcgctgaccctggagttcgacgaagcgggcatgcctttcctg
ctcaaaattaagaagcatggcgagattgaatgcttgctgatcatgtccacgctatccccc
gatgatataagcttctcggaagattattgtcaaaaggatctgacagtgcaggatgaggat
gtacgagcggcggccgcaaagcgaaagagcagcgtttcgaagccgaatgtgaccaacaaa
cgcaaaggcagctcttcggaaccggctgcagtgcagccaaaacggcgagttgaggagacc
caattagaatcgagcctagataatccactgtttcagttccgggactcggaggcgccatct
gttcagcaccctcgcatcctagccgaggtggacactgtggttctgattgaagatgaggcg
gaacaagaggctctcatgctggcagccgcggatgccgctttggaggccagcatggcacct
gctccagagccgccgaacagcacggaggtttgctttatcaacacagacgactctcaacaa
cctaaacctgcgaaaagctcctccgacgaggacgaaactataccccagtcacctgagcgc
cctaacaaggtgcgaaccatcttctcacgttgctttcagaggacctacgtgccgcgggag
ccctcacccaacactcaggtctatgcgcccaattccgatacagaggattag

DBGET integrated database retrieval system