KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3977
Entry
Dmel_CG3977       CDS       T00030                                 

Symbol
Ctr1A
Name
(RefSeq) copper transporter 1A, isoform B
  KO
K14686  solute carrier family 31 (copper transporter), member 1
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dme02000]
    Dmel_CG3977 (Ctr1A)
Transporters [BR:dme02000]
 Solute carrier family (SLC)
  SLC31: Copper transporter
   Dmel_CG3977 (Ctr1A)
SSDB
Motif
Pfam: Ctr
Other DBs
NCBI-GeneID: 31601
NCBI-ProteinID: NP_001245551
FlyBase: FBgn0062413
UniProt: Q9W3X9
Position
X
AA seq 231 aa
MDHAHHSAPGVDHSMHHDHVGMHHDHSGIPAATASPMDAASMFDLIPDTSDLQASHAGHA
AHGAHNHGGGSGTGMEHMMPMAFHFGYNETILFSWWHIETVAGLIGSMIAIFLLALMYEG
LKYYREYLFWKTYNLLEYRPVTGPQRNPEAPRIPSPAAAAPSPVQPSMLSINHLLQTLLH
VLQVTLSFLLMLIFMTYNVWLCLMVVLGAAVGYFLFCWKKSVIVDVTEHCH
NT seq 696 nt   +upstreamnt  +downstreamnt
atggaccacgcccatcacagtgcgcccggtgttgatcactcgatgcatcacgatcatgtg
ggcatgcaccacgatcacagcggtatacctgctgcgacagcgtctccaatggatgcagct
tccatgttcgacctgatccccgataccagcgatttgcaggcaagtcacgcgggtcacgcc
gctcacggagcgcacaatcatggcggtggctctggcacgggaatggagcacatgatgccc
atggcgttccattttggctacaacgagacgatcctgttctcctggtggcacatcgaaaca
gtggccggtttgatcggctccatgatcgccatcttcctgctggccctaatgtacgaggga
ctgaagtactaccgcgagtatctattctggaagacatacaatctgctggaatatcgacct
gtgacggggccacaaagaaatccggaggcaccgcgcataccatcgccggcagcggcagct
ccatcgcccgttcaaccttcgatgctgtcgattaaccacctgctccagacactgctgcac
gtgctccaggtgacgctgtccttcctgctcatgctgatcttcatgacatacaacgtgtgg
ctctgcctgatggttgtcctgggcgccgccgttggttacttcctcttctgctggaagaaa
tcggttatcgtggacgtaaccgagcactgtcactaa

DBGET integrated database retrieval system