KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3991Help
Entry
Dmel_CG3991       CDS       T00030                                 

Gene name
TppII
Definition
(RefSeq) tripeptidyl-peptidase II, isoform D
  KO
K01280  tripeptidyl-peptidase II [EC:3.4.14.10]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dme01002]
    Dmel_CG3991 (TppII)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:dme03110]
    Dmel_CG3991 (TppII)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.10  tripeptidyl-peptidase II
     Dmel_CG3991 (TppII)
Peptidases and inhibitors [BR:dme01002]
 Serine peptidases
  Family S8: subtilisin family
   Dmel_CG3991 (TppII)
Chaperones and folding catalysts [BR:dme03110]
 Intramolecular chaperones
  Subtilisin family
   Dmel_CG3991 (TppII)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPPII_N Peptidase_S8 TPPII RNA_binding Y_Y_Y
Motif
Other DBs
NCBI-GeneID: 36444
NCBI-ProteinID: NP_725252
FlyBase: FBgn0020370
UniProt: Q9V6K1
Structure
PDB: 

Position
2R
AA seq 1441 aa AA seqDB search
MFNRFRLVHKQLRLYKNFGLLGQKASVGLTLPIISLSRPYMAYMGTERSVVMITAPATKE
FAESSERSNSSKKTTNKEQSDKSAESRMATSGIVESFPTGALVPKAETGVLNFLQKYPEY
DGRDVTIAIFDSGVDPRATGLETLCDGKTVKVIERYDCSGCGDVDMKKKVTPDENGNIKG
LSGNSLKLSPELMALNTDPEKAVRVGLKSFSDLLPSKVRNNIVAQAKLKHWDKPHKTATA
NASRKIVEFESQNPGEASKLPWDKKILKENLDFELEMLNSYEKVYGDIKTSYDCILFPTA
DGWLTIVDTTEQGDLDQALRIGEYSRTHETRNVDDFLSISVNVHDEGNVLEVVGMSSPHG
THVSSIASGNHSSRDVDGVAPNAKIVSMTIGDGRLGSMETGTALVRAMTKVMELCRDGRR
IDVINMSYGEHANWSNSGRIGELMNEVVNKYGVVWVASAGNHGPALCTVGTPPDISQPSL
IGVGAYVSPQMMEAEYAMREKLPGNVYTWTSRDPCIDGGQGVTVCAPGGAIASVPQFTMS
KSQLMNGTSMAAPHVAGAVALLISGLKQQNIEYSPYSIKRAISVTATKLGYVDPFAQGHG
LLNVEKAFEHLTEHRQSKDNMLRFSVRVGNNADKGIHLRQGVQRNSIDYNVYIEPIFYND
KEADPKDKFNFNVRLNLIASQPWVQCGAFLDLSYGTRSIAVRVDPTGLQPGVHSAVIRAY
DTDCVQKGSLFEIPVTVVQPHVLESDQNTPVFEPASSKGDNSVEFQPNTIQRDFILVPER
ATWAELRMRITDPNRGEDIGKFFVHTNQLLPKQSCRKLETMKIVSVGSENESIMAFKVKS
GRILELCIAKYWSNYGQSHLKYSLRFRGVEAHNPNAYVMHAGRGIHKLEIEALVAEDVQP
QLQLKNAEVVLKPTEAKISPLSATRDVIPDGRQVYQNLLAFNLNVAKAADVSIYAPIFND
LLYEAEFESQMWMLFDANKALVATGDAHSHTSFTKLDKGEYTIRLQVRHEKRDLLEKISE
ANLVASFKLTSPLTLDFYENYNQCIVGGRKYVSSPLRLSTRVLYIAPITQERLTKANLPA
QCAWLSGNLVFPQDEVGRRVAQHPFTYILNPAEKKSHTNGSSNGSSAAGSTATAAAVTTA
NGAKPKAPATPQAATSVTNPAAGDGISVQNDPPVDSSGSPASPKKGKANADDYAESFRDF
QCSQIVKCELEMAEKIYNDVVAAHPKHLQANLLLIQNIESNQLKSQLPLTFVNAQKTSPP
EAGESADKQKEDQKKVRSALERIVKLADKVIQETDSEALLSYYGLKNDTRADAAKIKTNM
DKQKNTLIEALSKKGIAVAKLAVLDDCIKDSLAEINELYTEIIKFVDANDSKAIQFALWH
AYAHGHYGRMYKYVVKLIEEKRTRDHFVELAAINGALGHEHIRTVINRMMITAFPSSFRL
F
NT seq 4326 nt NT seq  +upstreamnt  +downstreamnt
atgtttaacagattccgattggtgcacaaacagctgcggttatataagaatttcgggctg
ctgggccagaaggccagcgtgggactcacattgccgatcatcagcttgtccaggccgtac
atggcgtatatgggcaccgagaggagcgtggtgatgatcaccgcaccagctacgaaggaa
ttcgcagagagttctgagcgcagcaatagcagcaagaagactaccaacaaagagcagagc
gacaaatcagcggagagcaggatggccaccagcggtattgtcgagtcatttcccacgggc
gcactggtgcccaaggcggagacgggagtcctgaactttctgcagaagtacccggagtac
gatggacgcgacgtcaccatagccatcttcgattccggcgtcgatccccgggcaacggga
ctggagacgctgtgcgatggaaagaccgttaaagtaatagagcggtacgactgttccgga
tgcggcgacgtggacatgaagaagaaggtgacgccggacgagaacggcaacattaagggc
ctgtccggaaactcgctcaagctgagtccggagctgatggctctgaacacagatccggag
aaggcggtgcgggtaggcctcaagagcttcagcgatttgttgccctccaaggtgcggaac
aacattgtggcccaggccaagctgaagcactgggacaagccgcacaagacggccactgca
aacgccagtcgcaagattgttgaatttgagtcacaaaatccaggagaagcctcaaaactg
ccctgggacaagaagatattgaaagagaatctagactttgagctagagatgttgaatagc
tacgagaaggtgtacggcgacattaagacctcctacgattgcatcctttttcccacggcc
gacggatggctgacaatcgtcgacaccacggagcagggcgatctggatcaggctctgcgc
attggcgagtattcccgcacgcacgagacccgcaatgtggacgactttctttccatatcg
gtaaacgtccacgacgagggcaacgtactggaggtggtcggcatgagctcaccccacggc
acccacgtatcgtctattgccagcggcaaccatagctcccgggacgtggatggcgtggcg
ccgaatgctaagatcgtttctatgaccatcggtgatggtcgacttgggtctatggagacc
ggcacggcactagtgcgtgccatgactaaggtgatggaactatgtcgcgatggcagacgc
atcgatgtgatcaacatgagctatggcgagcatgccaattggtcaaattccggccgcatt
ggggagctcatgaacgaggttgtcaacaagtatggcgtggtgtgggtggcatcggccggc
aaccatggtccggcactttgtactgtgggaactccgccggacatcagccagcccagtttg
atcggcgtgggcgcgtacgtatcaccccaaatgatggaggccgagtatgcgatgcgagaa
aagctgcccgggaacgtgtacacctggacatcgcgagatccctgcatcgacggaggtcaa
ggcgttaccgtatgcgctccgggcggagccattgcgtccgtgccacagtttactatgagc
aagtcccagctgatgaacggtaccagcatggcggcacctcacgtcgccggcgcagtggcg
ctgctcatctccggtctgaagcaacagaacatcgagtattcgccgtacagtattaagcga
gcgatcagcgtcactgccaccaaactgggctatgtagatccctttgctcagggccatggc
ttgctcaatgtcgagaaggcattcgagcatttgacggagcaccgccagtccaaggataat
atgctcaggttctccgtgcgcgtgggcaacaacgcagacaagggcattcatttgcgtcag
ggcgtgcagcgtaactccatcgattacaacgtttatatagagcccatcttctacaatgac
aaggaggcggatcccaaggacaagtttaacttcaatgtacggctaaatctgattgcctcg
cagccgtgggtgcagtgtggagctttcttggatctcagctatggcacccgctccattgcc
gtgcgcgtcgatcccactggactccagccaggcgttcacagcgctgtgattcgggcttat
gacactgactgcgtacagaagggttctctctttgagattcctgtcacggtggtgcagccc
catgtgctggagtcggatcagaacacgcccgtcttcgaacccgcctcttccaagggagac
aacagcgtggagtttcagccaaacaccattcaaagagacttcatcctggtgccagaacgt
gctacttgggcggagttgcgtatgcgtataaccgatcccaatcgtggcgaggacattgga
aagttctttgtacacacgaaccaacttcttcccaagcaatcctgtcgtaagcttgagacc
atgaagatcgtatcggttggctcggaaaacgaatctataatggcttttaaagttaagtct
ggcaggattctggagctatgcattgccaagtactggtccaactacggccagagtcacctg
aagtacagcttgcgtttccgtggcgtggaagcgcacaatcccaatgcctacgtcatgcat
gcgggcaggggaattcataagctggagattgaggccctggttgccgaggatgtgcagccc
cagctacagctaaagaatgccgaagtggtgctaaaaccgaccgaggccaagatctcgccg
ctaagcgccacacgagacgtcatcccagatggacgtcaggtgtatcagaacctgctggcc
tttaacttgaacgtggccaaggccgcagatgtgtcgatatacgcaccgatctttaacgac
ttgttgtatgaagcggagtttgagtcacagatgtggatgctttttgatgcaaacaaggcc
ctggtggccaccggcgatgctcactcccacacttccttcacaaagctcgataagggcgaa
tacacaatcagactgcaggtgcgtcacgagaagcgcgacctgctggagaagatctcggag
gcaaatctggtggcctcattcaagctgactagccccctcacccttgatttctatgagaac
tacaatcagtgcatagtgggaggtcgtaaatacgtctcgagtccgctaaggctgtccact
cgggtgctttatatcgctcctattacccaagagcgacttaccaaggccaatctgcccgct
caatgcgcctggctgagcggcaatctggtattcccgcaagatgaggtcggacggcgagtg
gctcagcatccatttacttacatcctcaatcccgctgagaaaaagtcacacacgaatggc
tcgagcaacggttccagcgctgcaggatccacagctacggcagctgctgtcaccactgct
aatggcgcaaaaccgaaagctccggcgactccacaagcggccacctcagtgaccaatcct
gcggccggcgatggaatttctgttcagaacgacccgcctgtggacagcagtgggagtccc
gcctcacccaaaaagggcaaggccaatgccgacgattatgccgaaagttttcgcgacttt
caatgttcgcagattgtcaagtgtgaactggaaatggcagagaaaatctataatgatgta
gtcgctgcccatcccaagcatttgcaggcaaacctgctacttatccagaacatcgagtcc
aatcagctgaagtcgcaactgccgctgactttcgtcaatgctcaaaagacatcgccacca
gaggcaggcgagagcgccgacaagcaaaaggaggatcaaaagaaagtacgaagcgccctg
gagcgaattgttaagctggccgacaaggtgatccaggagaccgattccgaggcactgctc
tcctactacggtctgaagaacgacactcgtgccgatgcagccaagataaagaccaacatg
gacaaacagaaaaacactctcattgaggcgctaagcaagaagggcattgctgtggcaaag
ctggctgtattagacgactgtatcaaggatagcctggctgagatcaacgagctgtatacc
gagattatcaagttcgtggacgccaacgactccaaggccatccagttcgctctgtggcac
gcctatgcccatggccactacggtcgcatgtacaagtatgtggttaagctaatcgaggag
aagcgaacccgcgatcacttcgtggagctggccgccatcaacggcgccctgggtcacgag
cacatccgtactgtcatcaaccgtatgatgatcactgcctttcccagcagcttccgtttg
ttctga

DBGET integrated database retrieval system