KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4005Help
Entry
Dmel_CG4005       CDS       T00030                                 

Gene name
yki
Definition
(RefSeq) yorkie, isoform F
  KO
K16687  transcriptional coactivator YAP1
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04391  Hippo signaling pathway - fly
dme04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04391 Hippo signaling pathway - fly
    Dmel_CG4005 (yki)
   04392 Hippo signaling pathway - multiple species
    Dmel_CG4005 (yki)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WW FAM181
Motif
Other DBs
NCBI-GeneID: 37851
NCBI-ProteinID: NP_001036568
FlyBase: FBgn0034970
UniProt: Q45VV3 A0A0C4DHD4
Position
2R
AA seq 395 aa AA seqDB search
MLTTMSASSNTNSLIEKEIDDEDMLSPIKSNNLVVRVNQDTDDNLQALFDSVLNPGDAKR
PLQLPLRMRKLPNSFFTPPAPSHSRANSADSTYDAGSQSSINIGNKASIVQQPDGQSPIA
AIPQLQIQPSPQHSRLAIHHSRARSSPASLQQNYNVRARSDAAAANNPNANPSSQQQPAG
PTFPENSAQEFPSGAPASSAIDLDAMNTCMSQDIPMSMQTVHKKQRSYDVISPIQLNRQL
GALPPGWEQAKTNDGQIYYLNHTTKSTQWEDPRIQYRQQQQILMAERIKQNDVLQTTKQT
TTSTIANNLGPLPDGWEQAVTESGDLYFINHIDRTTSWNDPRMQSGLSVLDCPDNLVSSL
QIEDNLCSNLFNDAQAIVNPPSSHKPDDLEWYKIN
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgttaacgacgatgtcagccagcagcaatacaaacagcctgatcgagaaggagatcgac
gacgaggacatgctttcgccgatcaagtccaacaacctggtggtgcgggtcaaccaggac
acggacgacaacctgcaggcgctattcgacagcgtcctgaatccgggtgacgccaagcgc
ccgctgcagctgcccctgcgcatgcggaagctgcccaactccttcttcacgcccccggcg
ccctcgcactcgcgggccaacagcgccgactccacctacgacgcgggctcccagtcgagc
atcaacatcgggaacaaggcgtccatcgtccagcagccagatggccagtcgcccatcgcc
gccatcccccagctccagattcagccgtctccccagcacagccgcctggcgatacatcac
tcccgagcccgcagcagccccgcctcgctgcagcagaactacaatgtgcgcgcccggagc
gacgcagcagcagccaacaatccgaatgccaatccgagcagccaacagcagcccgctggg
cccactttcccagagaacagtgcccaagagttccccagcggcgccccggccagctcggcc
attgatctggacgccatgaacacctgcatgtcgcaggacattcccatgtccatgcagaca
gtgcacaagaagcagcgctcctacgacgtcatcagccccattcagttgaaccgccaacta
ggcgccttgccgccgggatgggagcaagccaagaccaatgatggccagatctactacttg
aatcatactacaaaatctacgcagtgggaggatcccagaatccaatatcgccagcagcag
caaatcttgatggccgagcgaataaagcagaatgatgttttgcaaactacaaaacaaact
accacatcgaccattgctaacaatttgggtccactgccggatggttgggagcaggcagtt
accgagtccggagatctttactttataaatcacattgatcgaacgacttcatggaatgat
cccagaatgcaatctgggcttagcgtgctcgactgcccagataacttagtgtcttccctc
cagattgaggataatctttgcagtaacttgttcaatgacgcacaggccattgtaaatccg
ccgtcttcccacaaacctgacgatttggaatggtataaaattaattaa

DBGET integrated database retrieval system