KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4006
Entry
Dmel_CG4006       CDS       T00030                                 

Gene name
Akt1
Definition
(RefSeq) Akt1, isoform C
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04068  FoxO signaling pathway
dme04140  Autophagy - animal
dme04150  mTOR signaling pathway
dme04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    Dmel_CG4006 (Akt1)
   04150 mTOR signaling pathway
    Dmel_CG4006 (Akt1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    Dmel_CG4006 (Akt1)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    Dmel_CG4006 (Akt1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dme01001]
    Dmel_CG4006 (Akt1)
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Dmel_CG4006 (Akt1)
Protein kinases [BR:dme01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   Dmel_CG4006 (Akt1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11
Other DBs
NCBI-GeneID: 41957
NCBI-ProteinID: NP_732113
FlyBase: FBgn0010379
UniProt: Q8INB9
Position
3R
AA seq 611 aa
MNYLPFVLQRRSTVVASAPAPGSASRIPESPTTTGSNIINIIYSQSTHPNSSPTSGSAEK
FSWQQSWPSRTSAAPTHDSGTMSINTTFDLSSPSVTSGHALTEQTQVVKEGWLMKRGEHI
KNWRQRYFVLHSDGRLMGYRSKPADSASTPSDFLLNNFTVRGCQIMTVDRPKPFTFIIRG
LQWTTVIERTFAVESELERQQWTEAIRNVSSRLIDVGEVAMTPSEQTDMTDVDMATIAED
ELSEQFSVQGTTCNSSGVKKVTLENFEFLKVLGKGTFGKVILCREKATAKLYAIKILKKE
VIIQKDEVAHTLTESRVLKSTNHPFLISLKYSFQTNDRLCFVMQYVNGGELFWHLSHERI
FTEDRTRFYGAEIISALGYLHSQGIIYRDLKLENLLLDKDGHIKVADFGLCKEDITYGRT
TKTFCGTPEYLAPEVLDDNDYGQAVDWWGTGVVMYEMICGRLPFYNRDHDVLFTLILVEE
VKFPRNITDEAKNLLAGLLAKDPKKRLGGGKDDVKEIQAHPFFASINWTDLVLKKIPPPF
KPQVTSDTDTRYFDKEFTGESVELTPPDPTGPLGSIAEEPLFPQFSYQGDMASTLGTSSH
ISTSTSLASMQ
NT seq 1836 nt   +upstreamnt  +downstreamnt
acgaattacctaccgtttgttcttcagcggcgatcgactgtggttgccagcgccccagcg
ccaggatctgcctctaggatcccggaatcgcccaccaccacagggagcaacatcattaac
atcatctacagccaatccacccatccaaacagcagccccaccagcggcagtgcagagaaa
ttcagctggcagcaatcctggccaagcaggacctccgcggcccctacacacgattccgga
accatgtcaataaacacaactttcgacctcagctcgcccagcgttacatcgggtcatgcg
cttacggaacagactcaggtcgtaaaggaggggtggctgatgaagaggggcgagcacata
aagaactggcgccagcgctacttcgtgctccactccgatggaagactgatgggttaccgc
agcaagccggcagatagtgccagcacgccatcggacttcctgctcaacaactttacggtg
cgcggctgccagatcatgaccgtcgatcggcccaagccattcaccttcatcatccgcggc
ctgcaatggaccacggtaatcgaaaggacatttgccgtcgaatcagaattagagcgccag
cagtggacggaggccattcgcaacgtatccagccggctcatagatgtgggtgaggtggct
atgacgccatctgaacagacagacatgacagacgtggacatggccaccattgccgaggac
gagctttccgagcagttctccgtacagggaacgacttgtaatagcagcggcgttaagaaa
gtgactttggagaattttgagttcctcaaggtgctcggcaagggcacctttggtaaggtt
attttgtgtcgcgagaaggctaccgccaagctgtacgcgatcaaaattcttaaaaaggaa
gttattatccaaaaggacgaggtggcccataccctgaccgagagtcgtgtgctcaagtcc
acaaatcatccgttcctcatttcactcaaatattcgtttcaaaccaacgaccgcctgtgt
tttgtgatgcagtacgtgaacggtggcgagctcttttggcatttaagccacgaacgcata
tttactgaggatcgaacacgtttctatggggcagagatcatttctgctctgggctatctg
cattcacagggcataatttatcgcgacttaaagctggaaaatcttttgctggacaaagat
ggtcacataaaggtcgcagacttcggtctgtgcaaggaggacatcacctacggccgcaca
acgaaaaccttctgcggtacaccggaatacctagctccggaagtattagatgacaatgat
tatggccaagcggtggactggtggggcactggcgtggtcatgtacgagatgatctgtggt
cgtcttccgttttacaatcgtgatcatgatgtgctctttacattgattttggtggaggag
gtaaaattcccgcgtaatatcacagatgaggcgaaaaatctgttagcaggccttctagct
aaggatcccaaaaagcgtttgggaggtggaaaggatgatgtcaaggagatacaagcacat
ccattctttgcgagtattaactggacagatctagtgttgaaaaaaataccgccgcctttc
aagcctcaggtgacatccgatacggatacaaggtacttcgacaaggagtttacgggagag
agtgtggagttgacgccgccggatcccactggcccgttgggctccatagccgaagagccg
cttttcccgcagttcagctaccaaggagacatggcctccacgttgggcacctcgtcgcac
attagtacttccacaagtctcgcatcgatgcaatag

DBGET integrated database retrieval system