KEGG   Drosophila melanogaster (fruit fly): Dmel_CG40228
Entry
Dmel_CG40228      CDS       T00030                                 

Gene name
CG40228
Definition
(RefSeq) uncharacterized protein, isoform C
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: Elf1
Other DBs
NCBI-GeneID: 5740664
NCBI-ProteinID: NP_001104426
FlyBase: FBgn0063670
UniProt: Q8MQI6 L7EEF9
Position
3L
AA seq 82 aa
MGRRKSKRKPPPKRKNIEPLDQQFNCPFCNHEKSCEVKMDKSRNTAKITCRVCLEDFQTG
INFLSEPIDVYNDWVDACETAN
NT seq 249 nt   +upstreamnt  +downstreamnt
atggggagaaggaagtctaaaagaaaaccgcctccgaagagaaagaatattgaacccctt
gatcaacaatttaattgtccattttgcaaccatgaaaaatcgtgtgaggttaaaatggat
aaaagcagaaatacagcgaaaataacttgtagggtgtgcttggaggattttcaaacggga
attaacttcctttcagaacctatcgatgtttacaatgattgggtagatgcctgtgaaaca
gcaaattaa

DBGET integrated database retrieval system