KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4043Help
Entry
Dmel_CG4043       CDS       T00030                                 

Gene name
Rrp46
Definition
(RefSeq) Rrp46
  KO
K12590  exosome complex component RRP46
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme03018  RNA degradation
Module
dme_M00391  Exosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:dme00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    Dmel_CG4043 (Rrp46)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dme03019]
    Dmel_CG4043 (Rrp46)
Messenger RNA biogenesis [BR:dme03019]
 Eukaryotic Type
  mRNA degradation factors
   3'-5' decay
    Core exosome factors
     Dmel_CG4043 (Rrp46)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNase_PH RNase_PH_C
Motif
Other DBs
NCBI-GeneID: 41270
NCBI-ProteinID: NP_650001
FlyBase: FBgn0037815
UniProt: Q9VGZ2
Position
3R
AA seq 233 aa AA seqDB search
MNLPAKMDVEKDKLRQMHCEFNPLSRCDGSVMYSQGATGLIGAVLGPIEVKTQNLSIDGS
YLECNYRPKAGLPQVTDRIREAAIRDVLELALLSEAHPRSKMSVQIQELEDRGSIDACAV
NCACLAMLIGGLPLKYSFAAVHAIINEQGEYVLDPDQSETLHQRASFTFAFDSVEGNLLL
IQTKGSFKIAQFNDIECLCLAASAEIFQFYRNQVAKYHGRSEATAKKEDVNET
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaccagcgaaaatggacgtggaaaaggataagcttcgccagatgcactgcgaa
ttcaatcccttgtcgcgttgcgacggatccgtgatgtacagccagggtgctacaggtctc
ataggcgcagttctcggccccatcgaggtgaagacccaaaacctgagcatagatggcagc
tacttggagtgtaactaccgaccaaaagcgggcctgccgcaggttaccgatcggattcgg
gaggcggccattcgggatgtgctggaactggccctcctgtcggaggctcatccgcgctcc
aagatgtccgtgcagatccaggagctggaagatcgtggcagtattgatgcctgcgccgta
aattgcgcctgcctagccatgctcatcggaggcctgcctttaaagtatagctttgcggct
gtccacgccatcatcaacgagcagggcgagtatgtgctagatccggaccaaagtgaaacc
ctccaccagcgcgccagttttacattcgcctttgattctgtagaaggaaaccttttgttg
atccagacaaagggctctttcaaaatagcccagttcaatgatattgagtgcctatgcctg
gctgccagtgccgagatctttcagttctatcgcaaccaggttgcaaagtatcatggcagg
agtgaggcgacggctaagaaggaggacgtcaatgagacgtga

DBGET integrated database retrieval system