KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4083
Entry
Dmel_CG4083       CDS       T00030                                 

Gene name
Mo25
Definition
(RefSeq) Mo25, isoform B
  KO
K08272  calcium binding protein 39
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    Dmel_CG4083 (Mo25)
SSDB
Motif
Pfam: Mo25 HEAT_2
Other DBs
NCBI-GeneID: 39858
NCBI-ProteinID: NP_001261958
FlyBase: FBgn0017572
UniProt: P91891 M9PI82
Position
3L
AA seq 339 aa
MPLFGKSQKSPVELVKSLKEAINALEAGDRKVEKAQEDVSKNLVSIKNMLYGSSDAEPPA
DYVVAQLSQELYNSNLLLLLIQNLHRIDFEGKKHVALIFNNVLRRQIGTRSPTVEYICTK
PEILFTLMAGYEDAHPEIALNSGTMLRECARYEALAKIMLHSDEFFKFFRYVEVSTFDIA
SDAFSTFKELLTRHKLLCAEFLDANYDKFFSQHYQRLLNSENYVTRRQSLKLLGELLLDR
HNFTVMTRYISEPENLKLMMNMLKEKSRNIQFEAFHVFKVFVANPNKPKPILDILLRNQT
KLVDFLTNFHTDRSEDEQFNDEKAYLIKQIKELKPLPEA
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgccactgttcgggaagtcacagaagtcgccagtggagctggtcaagtcgctgaaggag
gcgatcaacgccctggaggcgggcgaccgcaaggtggagaaggcgcaggaggacgtcagc
aagaacctggtctcgatcaagaacatgctgtacggtagcagcgatgccgagccgccggcg
gactacgtggtggcccagctgtcccaggagctgtacaacagcaacctgctgctgctgctc
atccagaacctgcaccgcatcgatttcgagggcaagaagcatgtggcgctcattttcaat
aatgtgctgcgccgccagattggcacccgttcgcccaccgtcgagtatatatgcacgaag
ccggagatcctgttcaccctgatggccggctacgaagatgcgcatccggagatcgcactg
aactccggtaccatgctgagggagtgcgcccggtacgaggcgctggccaagatcatgctg
cactcggatgagttcttcaagttcttccgctacgtggaggtttccacctttgacattgcc
agcgatgccttttctacgttcaaggagctgctcacgcgccataagctgctgtgcgcggag
tttctggacgccaactacgacaagttcttctcgcagcactaccagcgcctgctcaactcg
gagaactatgtgacgcggcgtcagagcttgaagctgcttggggaactgctgctggaccgg
cacaatttcaccgtgatgacgcgctacatatccgagccggagaacctcaagctaatgatg
aacatgctcaaggaaaagtcgcgcaacattcagttcgaggcgtttcacgtcttcaaggtg
ttcgtggccaatcccaacaagccgaagcccattctggacatcctgctgcgcaaccagacg
aagctggtcgactttctgaccaacttccatacggatcgctccgaggacgagcagttcaac
gacgagaaggcctatctgatcaagcagataaaggagctgaagccgctgcccgaggcttag

DBGET integrated database retrieval system