KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4167Help
Entry
Dmel_CG4167       CDS       T00030                                 

Gene name
Hsp67Ba
Definition
(RefSeq) heat shock gene 67Ba
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB OrthologParalogGFIT
Motif
Pfam: HSP20
Motif
Other DBs
NCBI-GeneID: 39076
NCBI-ProteinID: NP_523998
FlyBase: FBgn0001227
UniProt: P05812
Position
3L
AA seq 445 aa AA seqDB search
MSLIPFILDLAEELHDFNRSLAMDIDDSAGFGLYPLEATSQLPQLSRGLGRGNAMMWVPI
KGQSAASQHRHHPYNRVAGAKTACCNKSLVELEKELGDKGTSGASGSTSGQPAASKSAYS
VVNRNGFQVSMNVKQFAANELTVKTIDNCIVVEGQHDEKEDGHGVISRHFIRKYILPKGY
DPNEVHSTLSSDGILTVKAPPPLPVVKGSLERQERIVDIQQISQQQKDKDAQPPKPSEVE
QQAAASATTSTLNPTAPTPTPSLSLTLAESNGNGQEETEMEMPAVSPPISNEAAAAAAVA
VEAPSTAGTTSSANNGVAEPESESMEVALAKNEETANVDEPTPNPVISIEEEQKAEDANA
NEVPVASNNGNGAVAAAEDVEMPLAKKPEISTEDSKEEQAEKVDKVEKVEEKGGEELAAV
DAAILLAKNQGENGATAAKTEELAK
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgataccgttcatactagatttggccgaggagctgcacgatttcaatcgcagc
ctggcaatggatatagatgattcggccggattcgggttgtatccactggaggccacctca
cagttgccacagctgagtcgtgggttggggcgtgggaatgcaatgatgtgggtgcccatc
aagggtcagtcggcggcatcgcagcatcgccatcatccgtacaatcgtgtggccggagcc
aagactgcttgctgcaataagtcgctggtggagctggaaaaggaattgggcgataagggc
acgtccggggcaagcggcagcaccagtggccaaccggcggccagcaaatccgcctactcc
gtggtgaataggaacggcttccaggtgagcatgaatgtgaagcagttcgccgccaacgaa
ctgaccgtcaagaccatcgataactgcatcgtggtcgagggtcagcacgacgagaaggag
gatggccacggggtgatctcgcgccacttcatccgcaagtacatcctgcccaagggctat
gatcccaacgaggtgcactcgaccctctcctcggacggcattctgacggtgaaggcgccg
ccaccacttccagtcgtcaaaggcagcctggaacgacaggagcgcatcgtagacatccag
cagatatcgcagcagcagaaggataaggatgcgcagccgccaaagccgtcagaggtagag
cagcaggcggcagctagtgccaccacttccactttaaatccgactgcacccacacccact
ccttcgctctcgctcactctcgccgagagcaacggcaacggtcaggaagagacagagatg
gaaatgccggctgtttcgccccccatttccaatgaggctgctgctgccgctgctgttgca
gtggaagccccttccaccgcaggaaccacttccagtgccaacaatggcgttgcagaacca
gaatcagagtccatggaagtggcgttggccaaaaacgaagagactgccaatgtggatgaa
cccacacccaatcccgttataagcatcgaagaggagcaaaaggcagaggatgcaaatgcc
aacgaagtgcccgttgcctcgaataacggcaatggagcagtcgcagcagccgaggatgtg
gaaatgccgctggccaagaaaccggaaatctccacggaagacagcaaagaggagcaggcg
gagaaggttgataaagtagagaaagtggaggagaagggcggcgaggaactggcagccgta
gatgcggccattctactggccaaaaaccaaggcgaaaatggagccactgcagccaaaacc
gaggaactggccaagtga

DBGET integrated database retrieval system