KEGG   Drosophila melanogaster (fruit fly): Dmel_CG42275
Entry
Dmel_CG42275      CDS       T00030                                 

Gene name
alpha-Man-Ia
Definition
(RefSeq) alpha-Mannosidase class I a, isoform J
  KO
K01230  mannosyl-oligosaccharide alpha-1,2-mannosidase [EC:3.2.1.113]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00510  N-Glycan biosynthesis
dme00513  Various types of N-glycan biosynthesis
dme01100  Metabolic pathways
dme04141  Protein processing in endoplasmic reticulum
Module
dme_M00073  N-glycan precursor trimming
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    Dmel_CG42275 (alpha-Man-Ia)
   00513 Various types of N-glycan biosynthesis
    Dmel_CG42275 (alpha-Man-Ia)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dmel_CG42275 (alpha-Man-Ia)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dme04131]
    Dmel_CG42275 (alpha-Man-Ia)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.113  mannosyl-oligosaccharide 1,2-alpha-mannosidase
     Dmel_CG42275 (alpha-Man-Ia)
Membrane trafficking [BR:dme04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    Dmel_CG42275 (alpha-Man-Ia)
SSDB
Motif
Pfam: Glyco_hydro_47
Other DBs
NCBI-GeneID: 31957
NCBI-ProteinID: NP_727407
FlyBase: FBgn0259170
UniProt: P53624
Position
X
AA seq 667 aa
MYRISPIGRKSNFHSREKCLIGLVLVTLCFLCFGGIFLLPDNFGSDRVLRVYKHFRKAGP
EIFIPAPPLAAHAPHRSEDPHFIGDRQRLEQKIRAELGDMLDEPPAAGGGEPGQFQVLAQ
QAQAPAPVAALADQPLDQDEGHAAIPVLAAPVQGDNAASQASSHPQSSAQQHNQQQPQLP
LGGGGNDQAPDTLDATLEERRQKVKEMMEHAWHNYKLYAWGKNELRPLSQRPHSASIFGS
YDLGATIVDGLDTLYIMGLEKEYREGRDWIERKFSLDNISAELSVFETNIRFVGGMLTLY
AFTGDPLYKEKAQHVADKLLPAFQTPTGIPYALVNTKTGVAKNYGWASGGSSILSEFGTL
HLEFAYLSDITGNPLYRERVQTIRQVLKEIEKPKGLYPNFLNPKTGKWGQLHMSLGALGD
SYYEYLLKAWLQSGQTDEEAREMFDEAMLAILDKMVRTSPGGLTYVSDLKFDRLEHKMDH
LACFSGGLFALGAATRQNDYTDKYMEVGKGITNTCHESYIRAPTQLGPEAFRFSEAVEAR
ALRSQEKYYILRPETFESYFVLWRLTHDQKYRDWGWEAVLALEKHCRTAHGYCGLRNVYQ
QEPQKDDVQQSFFLAETLKYLYLLFSDDSVLPLDEWVFNTEAHPLPIKGANAYYRQAPVT
LPVSNAS
NT seq 2004 nt   +upstreamnt  +downstreamnt
atgtatcgcatcagtccaattggacgcaaatcgaacttccactcgcgcgaaaaatgtctg
attggactcgtcctggtaacgttgtgcttcctctgcttcggcggcatcttccttctgccg
gacaatttcggcagcgatcgtgtcctgcgcgtctacaagcacttccgaaaggccggaccg
gagatctttatcccagccccgcccctcgccgcacacgccccccatcgcagcgaggatcca
catttcattggcgatcgccaacgtttggagcaaaagattcgcgccgaattgggcgatatg
ctcgatgagccaccggctgcgggtggaggcgaacctggacaattccaggtgctcgcccaa
caggctcaggctccagcacccgtcgccgctctggcggatcagccgctggatcaggacgag
ggacacgccgccattcccgttctggccgccccagttcagggggacaatgccgccagccag
gcctcgtcccatccacaaagttccgcccagcagcacaaccagcagcaaccacaactgcca
ttgggtggcggtggcaatgatcaggcgccggacacactggacgccacactggaagaacgg
cgtcagaaggtcaaagagatgatggaacatgcgtggcacaattacaaattgtatgcgtgg
ggcaaaaacgagctgcgtccgctttcgcagcgaccccattcggccagtatttttggatca
tacgatctgggtgctacaatcgtcgacggtctggataccctgtacattatgggactggag
aaggaatatcgcgagggtcgcgattggatcgagcgaaaattctcactggacaatatcagc
gcagagttgagtgttttcgaaacgaacattcgttttgttggcggcatgctgacgctgtac
gcctttacgggcgatccactgtacaaggagaaggcccagcacgttgccgacaagctgctg
cccgccttccaaacaccaacgggtattccctacgcgctggtcaacaccaagaccggtgtg
gccaagaactacggctgggcatccggcggcagttctatcctatccgaatttggcacactg
catctggaatttgcctatctgagcgacattaccgggaatccactgtatcgggaacgagtc
cagaccattcgccaagtgctcaaggagatcgagaaaccaaagggcctctatcccaacttc
cttaatcccaagacaggcaaatgggggcaacttcacatgtcattgggcgctctgggcgac
agctactacgagtacttgctgaaggcctggctgcaatccggccaaacggatgaggaagcc
cgcgagatgttcgacgaggcaatgctggccattctggataagatggtccgcacaagtccc
ggcggactgacatacgtctctgatctcaagttcgacaggctggagcataagatggaccat
ttggcttgcttctcgggtggcctcttcgctttgggagcggctacacgtcaaaatgactat
acggacaagtacatggaggtgggcaagggcattacgaatacctgccacgagagctacatc
agagcacccactcagctgggacccgaggcctttagattcagcgaagctgtggaggcgcga
gcactgagatcgcaggagaagtactacattctacggccagagactttcgagagctacttt
gtgctgtggcgactcacgcacgaccagaaataccgcgactggggctgggaggcggtcctc
gccctggagaagcactgccgcacggcgcacggatattgtggcctgcgcaacgtctaccag
caggagccgcaaaaggacgacgttcagcaaagcttcttcctcgccgaaacgcttaagtac
ctgtacttgctgttctcggacgattcggtgctgccgctggacgaatgggtgttcaacacg
gaggcccatccgctgccgatcaagggtgcgaatgcgtactatagacaggcgcccgtaacg
cttccggtttcgaacgcatcgtaa

DBGET integrated database retrieval system