KEGG   Drosophila melanogaster (fruit fly): Dmel_CG42349
Entry
Dmel_CG42349      CDS       T00030                                 

Gene name
Pkcdelta
Definition
(RefSeq) protein kinase C delta, isoform D
  KO
K06068  novel protein kinase C delta type [EC:2.7.11.13]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:dme00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    Dmel_CG42349 (Pkcdelta)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dme01001]
    Dmel_CG42349 (Pkcdelta)
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     Dmel_CG42349 (Pkcdelta)
Protein kinases [BR:dme01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   Dmel_CG42349 (Pkcdelta)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 Pkinase_C C1_2 Zf_RING Pkinase_fungal
Other DBs
NCBI-GeneID: 32191
NCBI-ProteinID: NP_001138191
FlyBase: FBgn0259680
UniProt: P83099 B7Z147
Position
X
AA seq 671 aa
MMFTRAQVRKQKTSNSSSQRPRSSGGSTRHETRYKQSSTSSSGAGSGLSGASGASGARRD
QYRDRDHYGKHSFELPRQHSKEEAYHRDRESSAGGVDRGERSGIGGNGGGVTGGGVYVDR
RTRPRSITNRRGAIKHQKTHDINGHRFVAKFFRQPTFCAFCNLFLWGFGKQGYQCIICQT
VVHKKCHDKLLGKCSGSVFTSASTILLRERFKIDMPHRFKPHTFMSPTFCDHCGSLMGGF
FIQGLKCEECDVNCHKKCERLTANLCGVNQKLIVEALNHVKRGAREARDSPSTPPSLNPA
YKIEASEEHDETSYTYSQFQKSGRFTAPATVIPRFKNYSVDDFHFLAVLGKGSFGKVLLA
ELRDTTYYYAIKCLKKDVVLEDDDVDSTLIERKVLALGTKHPYLCHLFCTFQTESHLFFV
MEYLNGGDLMFHIQESGRFSEERARFYGAEIISGLKFLHKKGIIYRDLKLDNVLLDYEGH
VRIADFGMCKLQIYLDKTADSFCGTPDYMAPEIIKGEKYNQNVDWWSFGVLLYEMLIGQS
PFSGCDEDELFWSICNEIPWFPVYISAEATGILKGLLEKDYTKRIGSQYSPAGDIADHIF
FRPIDWGLLEKRQIEPPFKPQVKHPLDTQYFDRVFTRERVRLTPIDKEILASMDQKQFHG
FTYTNPHITLD
NT seq 2016 nt   +upstreamnt  +downstreamnt
atgatgttcacacgtgcccaggtgcgcaaacagaagaccagcaattcgagcagccagcga
cctcggagctcgggaggatcgacccgccatgagacacgctacaaacagagctccaccagc
agtagtggagcaggcagtggcttaagtggcgccagtggagcctccggcgcccgaagggat
cagtaccgggacagggatcactatggaaagcattcctttgagctgccacgccagcactcc
aaggaggaggcctatcatcgagatcgggagagcagtgcgggtggtgtcgacaggggcgaa
aggagtggcattggtggcaatggtggtggcgtcaccggcggtggcgtctacgtggacaga
aggactcgcccgaggagcataaccaatcgacgcggggccatcaagcatcaaaaaacccac
gacatcaatggtcatcgttttgtggccaaattctttcgccagcccaccttttgtgccttc
tgcaatttgtttctctggggatttggcaaacagggctatcagtgcataatttgccaaacg
gtggtgcacaaaaagtgccatgacaagctcctgggcaaatgttccggttccgtcttcacc
tcagccagtacaattttactacgcgaacgtttcaagatcgatatgccacatcggtttaag
ccacacacttttatgtcgccgactttttgtgaccattgcggctcattaatgggtggattt
tttattcagggcctcaaatgcgaagaatgtgacgtgaattgtcacaagaaatgcgaacgg
ctcacggccaatttatgcggtgtcaatcagaaactcatcgttgaggcactcaaccacgtg
aagcgaggagcccgagaagcccgtgactcacccagcactccgcccagtttgaatccagcc
tataaaatcgaggccagcgaagaacacgatgaaacatcatatacatattcacaattccaa
aaatccggacgtttcactgcgccagcaacagtaatacctagatttaagaattattcggta
gatgatttccactttctggccgttcttggcaagggaagtttcggcaaggttctgcttgct
gagctgcgtgacaccacatactactatgccattaagtgcctgaaaaaggatgttgtcctg
gaggatgacgatgttgactccacgctcatcgaacgcaaggtcctggccctgggcaccaaa
cacccgtatctgtgtcatctgttttgcaccttccaaacggagagccacttgttctttgtg
atggagtacctgaatggcggtgatctcatgtttcatatccaggagagcggtcgcttttcg
gaggagcgagccagattctatggggccgaaatcatctcgggccttaaattcctgcacaaa
aagggcattatctatagagatctcaaactggataatgtcttgctggactacgagggacat
gttcgcattgccgattttggcatgtgcaagttgcaaatctatttggacaagacggcagat
agcttttgtggcacacccgattatatggcgcccgaaatcattaagggtgaaaagtacaat
cagaatgtggattggtggtcgtttggtgtgctgctctacgaaatgctaattggacagtcg
ccattcagtggctgcgatgaagacgagctcttctggtccatttgcaatgaaattccatgg
ttcccagtttacatatccgccgaggcaaccgggattctcaaggggttgctggagaaggac
tatacgaagcgtattggttcgcagtacagcccggctggtgatatagccgatcatatattc
ttccgcccgatcgattggggtttgctggaaaagcgacaaatcgagccgcccttcaagccg
caagtgaaacatcccctggatacccagtacttcgatcgggtcttcaccagggaaagggtg
cgtctaacacccatcgataaggagatattggcatccatggatcagaagcagttccacggc
ttcacctacacaaatcctcacatcaccttggactag

DBGET integrated database retrieval system