KEGG   Drosophila melanogaster (fruit fly): Dmel_CG42637Help
Entry
Dmel_CG42637      CDS       T00030                                 

Gene name
CG42637
Definition
(RefSeq) uncharacterized protein, isoform C
  KO
K01769  guanylate cyclase, other [EC:4.6.1.2]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00230  Purine metabolism
dme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Dmel_CG42637 (CG42637)
Enzymes [BR:dme01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     Dmel_CG42637 (CG42637)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc ANF_receptor Pkinase_Tyr Pkinase HNOBA
Motif
Other DBs
NCBI-GeneID: 40153
NCBI-ProteinID: NP_001007096
FlyBase: FBgn0261360
UniProt: Q7JQ32 A4V243
Position
3L
AA seq 1525 aa AA seqDB search
MTRWPFNLLLLLSVAVRDCSNHRTVLTVGYLTALTGDLKTRQGLAISGALTMALDEVNKD
PNLLPNVYLDLRWNDTKGDTVLATKAITEMICDGIATIFGPEGPCYVEAIVSQSRNIPMI
SYKCAEYRASAIPTFARTEPPDTQVVKSLLALLRYYAWNKFSILYEDVWSPVADLLKDQA
TKRNMTINHKQSFIDNRVKCCEQMLDCCRSGYWYQLVQNTMNRTRIYVFLGAANSLVDFM
SSMETAGLFARGEYMVIFVDMMVYSEREAEKYLRRVDQITFMSNCHSTENFNQMARSLLV
VASTPPTKDYIQFTKQVQKYSSKPPFNLEIPRLFVESNFSKFISIYAAYLYDSVKLYAWA
VDKMLREETRVLTDDVIFEVASNGTRVIDTIIKNRTYMSITGSKIKIDQYGDSEGNFSVL
AYKPHKWNNSNNMPCNYHMVPVAYFHQGEEHPEYKLINGSIDWPSGGEKPADEPMCGFAN
ELCKKDDTHYTSTVAAVVLGVLLFCSGVITMSIYRKWKIELEIEGLLWKIDPNEIKGYSG
NEIVSSPSKVSLMSAQSYGSRWTNQFVTSTGRLRGAVVRIKELKFPRKRDISREIMKEMR
LLRELRHDNINSFIGASVEPTRILLVTDYCAKGSLYDIIENEDIKLDDLFIASLIHDLIK
GMIYIHNSQLVYHGNLKSSNCVVTSRWMLQVTDFGLHELRQCAENESIGEHQHYRNQLWR
APELLRNHIHGSQKGDVYAFAIIMYEIFSRKGPFGQINFEPKEIVDYVKKLPLKGEDPFR
PEVESIIEAESCPDYVLACIRDCWAEDPEERPEFSVIRNRLKKMRGGKTKNIMDQMMEMM
EKYANNLEDIVTERTRLLCEEKMKTEDLLHRMLPQSVAEKLTMGQGVEPVSYDLVTIYFS
DIVGFTAMSAESTPLQVVNFLNDLYTVFDRIIRGYDVYKVETIGDAYMVVSGLPIKNGDR
HAGEIASMALELLHAVKQHRIAHRPNETLKLRIGMHTGPVVAGVVGLTMPRYCLFGDTVN
TASRMESNGEALKIHISNKCKLALDKLGGGYITEKRGLVNMKGKGDVVTWWLTGANENAI
QKKLVDMMDMPPPLFSRPRKSPKLNPDSRQPSIQAMHFCGTGSRRQSTVPRAMDGESTYS
LQGSVRESPRMVSKRDRDRERPPINGLGAGHFVGGALLESAQASLSTLNHSETNETNCDM
DGGSGGVSGSGSGLVRQPNALHKPLAMVRPHRIISAAQLPQLGDNDDDSADTLLRESRSL
DPMPMQQLRKRHDRVKLPPSKLSKNNSRSLDTGVSLISGNPNGEVHSSQLDLDNEMTANP
VDATDGYDDELGLLMRHDNGQLPALRYSGSFPNAQISIVPTGRSAGGGGGGREGGGSNCA
KHLNNNCNGGVNVEDDLESPLLQRQASLSVPPEEMLAHNKRWHSLEHMDGPGGHGGNSVS
YAADIDNRHPGDLDFFSGSSNQHHRSKAAGGSKLTNWMTNIFKGNGVRSGEARRVGILPS
GVHGARTGFTDMAASAAARDRESIV
NT seq 4578 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgttggccctttaatctactactcttgctgtcggtggcggtacgcgactgtagc
aatcatcgcaccgtcctcactgtcggctacctaacggccctcactggcgatctcaagacg
cgtcagggactggccatttccggtgccctgactatggccctggatgaggtcaacaaagat
cccaatcttctgccaaatgtgtacctggatctgcgctggaatgacaccaagggggacacg
gtactggccaccaaggccatcaccgagatgatatgcgatggcatcgccaccatttttggc
ccggaaggaccttgctatgtggaggccatcgtctcgcagagtcgaaacattccaatgatt
tcctacaaatgtgcagagtaccgtgcatccgccataccgacattcgcccgcaccgagccg
ccagatacacaggtcgttaagtcgctgcttgcccttctgcgatattatgcgtggaataag
ttttccattctgtacgaggatgtgtggagtccggtggctgatctgctgaaagatcaggcc
accaagagaaatatgacgatcaaccacaagcagtcgttcattgataatcgagtcaagtgc
tgtgagcagatgctggactgctgtcgttctgggtattggtaccagctggtgcaaaacacg
atgaatcgcacacgaatctacgtatttctgggggcggcgaatagtctggtggactttatg
agttccatggagaccgctggtctgtttgcccgtggcgagtatatggtgatctttgtcgac
atgatggtctattccgagagggaggcagaaaagtacttgcgcagagtggatcaaataaca
ttcatgtccaattgccatagcacggagaacttcaatcaaatggcccgcagtcttctcgtc
gtggcatccacgccacccacaaaggattacatacagttcactaaacaagtgcagaagtac
agctcaaagccgccgttcaatttggaaattcccaggctgtttgtagaaagtaattttagc
aagttcatatcgatctatgccgcgtacctgtacgattcggtaaagctgtatgcctgggct
gtggacaaaatgctgcgggaggagacccgagtcttgaccgatgatgtgatcttcgaggtg
gccagcaacggaacacgtgtaatcgataccataatcaaaaaccgtacttatatgagcata
actggatccaaaattaagatcgatcaatatggcgattcggagggtaatttttcggtcctg
gcctacaagccacacaagtggaataactcgaacaacatgccctgcaactatcacatggtt
cctgtagcttactttcatcaaggcgaagaacatccagagtacaagctcatcaatggctcc
atagattggccatcgggcggtgagaagcccgcagatgaaccgatgtgcggttttgcaaac
gagctgtgtaaaaaggacgacacccactatacgtccactgtcgccgctgtggttttgggc
gtattgctcttctgctcaggtgttatcaccatgagtatatatcggaagtggaagatcgag
ttggagattgagggcttactctggaagatcgatccgaacgaaataaagggttattctggc
aacgagattgtctcctcaccgagcaaagtcagtttgatgagtgcccagagctatggttcc
cgctggaccaaccagtttgttacctccacgggtcgccttcgcggggccgtggttcgtatt
aaggagttgaaattcccgcggaagcgagacatatccagggagatcatgaaggagatgcga
ttgttgcgcgaactgcgtcacgataacatcaacagcttcattggcgccagcgtggagcca
acacgcattcttctagtcaccgattactgtgccaaaggcagtctttacgacatcattgag
aacgaggacattaagttggacgatctattcatcgcctcgcttattcacgacctcataaag
ggcatgatctatatacacaactctcagctcgtctatcatggtaaccttaaatcctcaaac
tgtgtggtcacctcgcgttggatgctccaagtcaccgatttcgggctgcacgagttgcgg
cagtgtgccgaaaacgaatccatcggggagcatcagcattatcgaaatcaactttggcgc
gctccagagctgctgcggaatcacattcacggcagccagaagggcgatgtctatgccttt
gccatcatcatgtacgagatatttagtcgtaagggtccgttcggacaaattaactttgaa
ccaaaggaaatcgtagactatgtcaagaagctgccgctcaagggagaggatccctttcgg
ccggaagtggagtccattatagaggccgagtcctgtccggattacgtactggcctgcatc
agggactgctgggctgaagatcccgaagagcggcccgaattcagtgtcatacgcaatcgc
ttgaagaagatgcgtggtggtaagaccaagaacatcatggatcaaatgatggaaatgatg
gagaagtatgccaacaacttggaggacattgtcaccgagcgcacgcgtctcctgtgcgag
gaaaagatgaaaacggaggatctcctgcatcgcatgctaccgcaatcggtggctgaaaaa
ttgaccatgggtcagggtgtcgagcccgtttcatatgatttggtaaccatatattttagc
gacattgttggttttactgcaatgtcggcggagagcacaccgctgcaagtggtgaacttt
ttgaatgatctctacacagtgttcgatcgcatcatacgcggctatgatgtctataaagtt
gaaaccattggagatgcttacatggtggtttcgggtctgccaattaagaacggagatcga
catgcaggcgagatagcttcgatggccctggagctgctccacgctgtcaagcagcaccgc
atagcccatcgtcccaacgagacgctgaagctgcgcattggaatgcacacgggtccggtg
gtagcgggcgtggttggtctcaccatgccgagatactgcctttttggtgacaccgtgaat
acagcgtcccggatggagagcaacggagaggcgctaaagattcacatttccaataagtgc
aagctggcgctggacaaactgggtggtggctacataaccgagaaacgtggcctggtcaat
atgaagggcaagggcgatgtggttacttggtggctaaccggagccaacgagaatgctatt
cagaagaagttagtggatatgatggacatgccgccgccgctgtttagtcgacctcgaaag
agtccaaagctaaatcccgactcccgtcagccaagcatccaggccatgcacttctgcggc
accggatcaagacgccagagcacagttcccagggcgatggacggcgaatcaacgtatagc
ctccagggatccgtgagggaatcaccgcgcatggtcagcaaacgtgacagggatcgagag
cgaccccccatcaatggactgggcgcagggcacttcgtggggggagctctcctcgaatcc
gcacaggcctcgcttagcacgctgaatcattccgaaacaaacgaaactaactgtgatatg
gatgggggatcgggaggagtgtcaggatctggatctggattagtgcgtcaacccaatgca
ctgcacaaaccgttggccatggtgcggccgcaccggattattagtgctgcccagctaccc
caactgggagataacgatgatgactccgcagacacgctgttgcgggagtctcgctccctg
gatcccatgcccatgcagcaactgcgcaaacgtcacgacagggtaaagttgccgccctcg
aagttgtccaagaacaattcccgatcgctggacacgggtgtatcgctgatcagtgggaat
cccaacggtgaagtgcactcgagtcaactggatttggataacgagatgaccgccaacccg
gtggatgccaccgatggctacgacgatgagctgggccttctgatgcgccacgacaacggc
caactgcctgctctccgctattcaggcagctttcccaacgctcagattagcattgttcct
acaggaaggtcagcaggaggaggaggaggaggaagagaaggaggtgggagcaactgtgcc
aagcatctgaacaacaactgcaacggaggagtgaacgtcgaggatgatcttgagtcgccc
ctgctgcaacgccaggcatcgctgtcggtgccgccagaggagatgctggcgcacaacaaa
cgttggcactcactggagcacatggatggtcccggtgggcatggcggaaatagcgttagc
tatgccgccgatattgataaccgccaccccggagatctggacttcttcagcggttcctcc
aatcagcatcatagatccaaagcggctggtgggagtaagctgactaactggatgactaac
atcttcaagggcaacggcgtgcgtagcggtgaggctaggcgagtaggaatcctgcccagc
ggtgtgcacggcgcacgaaccggattcacggatatggcggcatcggcagcagcccgcgat
cgtgagagtatagtatag

DBGET integrated database retrieval system