KEGG   Drosophila melanogaster (fruit fly): Dmel_CG42640
Entry
Dmel_CG42640      CDS       T00030                                 

Symbol
PPO3
Name
(RefSeq) prophenoloxidase 3
  KO
K00505  tyrosinase [EC:1.14.18.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00350  Tyrosine metabolism
dme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    Dmel_CG42640 (PPO3)
Enzymes [BR:dme01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     Dmel_CG42640 (PPO3)
SSDB
Motif
Pfam: Hemocyanin_C Hemocyanin_M Hemocyanin_N Tyrosinase
Other DBs
NCBI-GeneID: 44513
NCBI-ProteinID: NP_524760
FlyBase: FBgn0261363
UniProt: Q9W1V6 S0AT10
Position
2R:23064769..23067183
AA seq 683 aa
MADKKNLLLLFDHPTEPVFMDKGGNGTVFDVPDSYVTDRYNQMCKKVQRRVSSASEKNVQ
VKEIAIPDLSCSMRLGRSEQFSIFLKSHRKMASHLIEIFTKMQTVDELQSVAVYARDRVN
PVLFNYALSVALLHRPDTKDLELPAFAQTFPDRFIDSKMLRSMREESFVVERSAARLPVV
SSVKYTASDLDVEHRLWYFREDLGVNLHHWHWHLVYPIEAPDRSIVDKDRRGELFYYMHQ
QIIARYNAERLSNHMARVQPFNNLDEPIAEGYFPKMDSLVASRAYPPRFDNTRLSDVDRP
NNQLRVGIDDMKRWRERIYEAIHQGYVLDTNNEKIVLDDAKGIDILGNIIEASDLTPNST
LYGDFHNMGHILIAYSHDPTNKHLEYAGVMGDASTAMRDPIFYKWHAFIDNMFQEHKRLL
SPYEKQELSFPDVRVESIQVESQGQVNRLTTFWQESDVDMSRGLDFVPRGHVLARFTHLQ
HHEFSYTIKVENSSEATRYGYVRIFLAPKLDDRNAPMLLEQQRLMMVELDKFVVTMPPGS
HTITRNSTESSVTIPFERTFRNLDKLEELQNFLCGCGWPQHMLIPKGRPEGLRFELFVMV
SNYEEDKVDQTVADCGCSIAASYCGLRDRLYPDRKSMGFPFDRKPRRGSEILENFLTPNM
CAVEVIITHEDRTEKLREVPARS
NT seq 2052 nt   +upstreamnt  +downstreamnt
atggccgacaagaagaatctgctccttctgttcgatcatcccacggagcccgtgttcatg
gacaagggtggcaatggcaccgtcttcgacgtgcccgactcctacgtgaccgatcgctac
aatcagatgtgcaagaaggtccagcggcgcgtgagcagcgcgtccgagaagaacgttcaa
gtcaaggagatcgccataccggatctcagttgctccatgagactgggccgctcggagcag
ttctcgatcttcctgaagtcccaccgcaagatggccagccacctgatcgagatcttcacc
aaaatgcagaccgtggatgagctgcagagcgtggcggtgtacgccagggatcgcgtcaat
ccggtgctcttcaactacgccttgtcggtggccctgctccaccgtccggacaccaaggac
ctcgaactgcccgcctttgcgcagaccttcccggatcgctttatcgactcgaagatgctt
cgcagcatgcgcgaggagtcctttgtggtggagcgctccgccgcccgcctgcccgtcgtc
agttcggtcaagtacaccgcctccgatctcgatgtggagcaccggctgtggtacttccgc
gaggacctgggcgtcaacctgcaccactggcactggcatctggtctatcccatagaggcg
cccgaccgcagcatcgtggacaaggaccgtcgtggcgagctgttctactatatgcaccag
cagatcattgcccgctacaatgccgagcggctgagcaaccacatggcccgggtgcagccg
ttcaacaacctggacgaaccaattgccgagggctacttccccaagatggactcgctggtg
gccagtagggcgtatcctccgcgcttcgataacacccggctgagcgatgtggaccggcct
aacaaccagttgagggttggcatcgatgatatgaagcgctggcgcgaacgcatctacgag
gccatccatcagggctacgttttggatacgaacaatgaaaagatcgtgctggatgacgct
aagggcatcgacatcctgggcaacatcatcgaggcttccgatctgacgcccaacagtacg
ctgtacggcgacttccacaacatggggcacatactgattgcctactcacacgatccgacc
aacaagcacctggagtacgcgggcgtgatgggcgacgcctccaccgcgatgcgcgatccg
atcttctacaagtggcacgccttcatcgacaatatgttccaggagcacaaacgtctgctt
tctccctatgagaagcaagagctcagctttccggacgttcgcgtcgagagcatccaggtg
gagagccagggtcaggtcaacaggctgaccaccttctggcaggagtccgatgtggacatg
tcccgtggccttgattttgtgccgcgcggccatgtcctcgctcggttcacccatctgcag
caccacgaattcagctacaccatcaaggtggagaactccagcgaggccacgcggtatggc
tacgtgcgcatcttcctggcgcccaagctggatgatcgcaatgcacccatgctgctggag
caacagcgcctgatgatggtggagctggacaagttcgtggttaccatgcctcccggcagc
catacgatcacccggaactccacggagtcgagtgtcaccattccgttcgagcgcaccttc
cgcaacctggacaagctggaggagctgcagaacttcttgtgcggctgcggttggccccag
cacatgctgattccgaagggtcggcccgagggtctgcgcttcgagctcttcgtcatggtt
tccaactacgaagaggataaggttgaccagacggtcgcagattgcggctgcagcatcgcc
gcttcctactgcggcctgcgcgatcgcctctatccggatcgcaagtccatgggcttcccc
ttcgatcgcaagccgcgtcgaggctccgagatcctggagaacttcctgacgcccaacatg
tgcgccgtggaggtcatcattacccacgaggaccgcaccgagaagcttcgcgaggtacca
gctcgctcctga

DBGET integrated database retrieval system