KEGG   Drosophila melanogaster (fruit fly): Dmel_CG42701
Entry
Dmel_CG42701      CDS       T00030                                 

Gene name
CngA
Definition
(RefSeq) cyclic nucleotide-gated ion channel subunit A, isoform A
  KO
K04950  cyclic nucleotide gated channel alpha 3
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:dme04040]
    Dmel_CG42701 (CngA)
Ion channels [BR:dme04040]
 Voltage-gated cation channels
  Cyclic nucleotide-gated channel (CNG)
   Dmel_CG42701 (CngA)
SSDB
Motif
Pfam: Ion_trans CLZ cNMP_binding Ion_trans_2
Other DBs
NCBI-GeneID: 36806
NCBI-ProteinID: NP_477116
FlyBase: FBgn0261612
UniProt: Q24278
Position
2R
AA seq 665 aa
MRHFKVKAMVQSLDISAITGQQTDAEPSKRSKPSALRRTLQALRQRLTKRNRPKPPDWFL
EKFSNTTNTDKIGKGCPAMEDAALSSEIRGSSVLCNRLSVDPTLQSHYRWLAIVSLAVLY
NIIFVVGRAVFWEINKSAPAFWYTLDYLCDFIYLLDTLVHMHEGFLDQGLLVRDAFRLRR
HYFHTKGWYLDVLSMLPTDLAYIWWPPETCSSLYLPCPVIVRLNRLLRINRLWEWFDRTE
TATGYPNAFRICKVVLAILVLIHWNACMYFAISYEIGFSSDSWVYNLNGTRNNTLQRQYI
YSFYWSTLTLTTIGETPTPENDVEYLFVVADFLAGVLIFATIVGNIGSMISNMNVARVEF
QNRMDGVKQYMAFRRVGHELEARVIRWFAYTWSQSGALDEERVLAALPDKLKAEIAIQVH
MDTLKQVRIFHDTEPGLLEALVLKLKLQVFSPGDYICRKGDVGKEMYIVKRGKLSVVGDD
GITVLATLGAGSVFGEVSVLEIAGNRTGNRRTANVRSLGYSDLFCLAKRDLWETLSDYPE
ARSTLTQRGCQLLRKDGLLDEQIFADSQRVHDSIEGGIEKLELSVENLNMRLARLLAEYT
ASQAKIKQRLAKLEMNGGPGTWRLECEPQSRARSGRLYSLQPKRRPRSRPDATAKSSDAA
KQNTL
NT seq 1998 nt   +upstreamnt  +downstreamnt
atgcgacatttcaaagtcaaagccatggtgcagtcgctggatatatccgccataacggga
cagcaaacagatgcggagccaagcaaacggagcaaaccctccgctttaagacgcactctg
caggcactgcgccagcgtctgactaaaaggaatcgccccaaaccgccggactggttcctc
gagaagttctccaacaccaccaacacggacaagattggcaagggttgtccggcgatggag
gatgcggcgctatccagcgaaatacgtggctccagtgtcctgtgcaaccgtctgtccgtc
gatcccaccctgcagtcgcattacagatggctggccatcgtttcactggcagtgctttac
aatatcatcttcgtggtgggacgtgcggtcttctgggagatcaataagagtgctcccgcc
ttttggtacacgctggactacctgtgcgactttatctatctgctggatacgctcgtccac
atgcacgagggatttttggaccaaggtctcctcgtgcgggatgcctttcggctgcgccgg
cactatttccacaccaagggctggtacctcgacgtcctgtccatgctgcccacggacttg
gcctacatctggtggccgccggagacctgctccagtctgtatctgccgtgtcccgtgata
gtgcgtctgaatcgtctgctcaggatcaatcgactgtgggagtggttcgatcgaacggag
acagcgacgggatatccgaatgccttccgcatctgcaaggtggtgctggccattttggtg
ctgatccactggaatgcgtgcatgtactttgccataagctacgaaatcggcttcagttcg
gactcgtgggtgtataatctgaatggaacgaggaacaatacgttgcagcggcaatatatc
tatagtttctactggtcgacgctaacgctgaccaccattggcgagactccaacgccggag
aacgatgtggagtatctgttcgtggtggccgatttcctggctggcgtcctaatcttcgcc
accattgtgggtaacattggctccatgatctccaacatgaatgtggcccgcgtggagttc
cagaatcgcatggacggagtcaagcagtacatggccttccggcgagtgggtcacgagctg
gaggcccgggtgatccgctggtttgcctacacgtggtcgcagagtggtgcgctggacgag
gagcgtgtgctggccgctctgccggacaagctgaaggcggagatcgctatccaggtgcac
atggatacgctgaagcaggtgcgcatcttccacgacacggaaccgggtctcctcgaggcc
ctggtgctgaagctcaaactgcaggtcttcagtccgggcgactatatctgtcgcaagggt
gacgtgggcaaggagatgtacatcgtgaagcgtggcaagttgtccgtcgtcggtgatgat
ggcatcaccgtgctggccaccttgggcgccggttcggtgttcggcgaggtttccgtactc
gagattgcgggcaatcggacgggcaatcggcgcaccgccaatgtgagatccctgggctac
tcggatctcttctgtctggcgaaacgggatttgtgggagaccctgtccgactatccggag
gccagatccacgctcactcagcgaggatgccagctgctgcgcaaggatggcttactggac
gagcaaatattcgctgattcacaaagggtacacgacagcatcgagggcggcatcgaaaag
ctggagctctcggtggagaacctcaacatgcggctggcccgcctcctggctgagtacacg
gcaagccaggccaagatcaagcagcgcctcgcgaagctggagatgaatggtggccctggc
acgtggcgattggagtgtgagccccagagtcgagctcgcagcggacgcctctattcgctg
cagcccaagcggcgcccacgttcgcgacccgacgcgactgccaagagcagcgatgctgcc
aagcagaacacactgtaa

DBGET integrated database retrieval system