KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4274Help
Entry
Dmel_CG4274       CDS       T00030                                 

Gene name
fzy
Definition
(RefSeq) fizzy
  KO
K03363  cell division cycle 20, cofactor of APC complex
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04120  Ubiquitin mediated proteolysis
Module
dme_M00389  APC/C complex
Brite
KEGG Orthology (KO) [BR:dme00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    Dmel_CG4274 (fzy)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dme04121]
    Dmel_CG4274 (fzy)
   03036 Chromosome and associated proteins [BR:dme03036]
    Dmel_CG4274 (fzy)
Ubiquitin system [BR:dme04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Target recognizing subunit
     Dmel_CG4274 (fzy)
Chromosome and associated proteins [BR:dme03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    Dmel_CG4274 (fzy)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 Ge1_WD40
Motif
Other DBs
NCBI-GeneID: 34968
NCBI-ProteinID: NP_477501
FlyBase: FBgn0001086
UniProt: Q24044
Position
2L
AA seq 526 aa AA seqDB search
MSQFNFVSDLQNALIMDGETRGPAPRWKKKLEASLNGSVNTTRSVLSVSYNTSFSGVQAP
TKTPGKSSEGKTKKSNTTPSKTPGGGDRFIPNRAATNFELAHFLVNKDSGDKSDEENDKA
TSSNSNESNVQASAHKGDRQKLISEVAQVGDSKGGRILCYQNKAPAAPETHNNPLKVVYS
IKTPISTKSGSRYIPTTSERILDAPDFINDYYLNLMDWSADNIVAVALGSCVYLWNAQTG
NIEQLTEFEEGDYAGSLSWIQEGQILAIGNSTGAVELWDCSKVKRLRVMDGHSARVGSLA
WNSFLVSSGSRDGTIVHHDVRAREHKLSTLSGHTQEVCGLKWSTDFKYLASGGNDNLVNV
WSAASGGVGTATDPLHKFNDHQAAVRALAWCPWQPSTLASGGGTADRCIKFWNVNNGTLM
KSVDSKSQVCSLLFSRHYKELISAHGFANNQLTIWKYPTMVKQADLTGHTSRVLQMAMSP
DGSTVISAGADETLRLWNCFAPDPLASKKAVSTSKGKQSVFRQSIR
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagttcaattttgtgagcgatttgcagaatgctctcatcatggacggcgagacg
cgcggacctgcgcccaggtggaagaagaagctggaggcgtctctaaatggaagtgtgaat
accactcggtcggtgctatccgtctcgtacaacaccagtttctcgggtgtccaggcgccc
acgaaaactccgggcaagagcagcgagggcaagaccaagaagtccaacaccacgccctct
aagacgccaggaggcggagatcgctttattccgaatcgggcggctaccaactttgagtta
gcacactttctggtgaacaaagactccggcgataagtccgatgaggagaacgacaaggcc
acctcgagcaacagcaacgagagcaatgtccaggcttcggctcacaagggcgaccggcag
aaactcatctctgaagtggcccaggtcggtgactccaagggcgggcgcattttgtgctac
caaaacaaggctcccgctgctccagaaacacacaacaatcccctgaaggtcgtgtactcc
attaagacacccatatccacaaagagtggctcacgctatatacccaccacatccgagagg
attctggatgcacctgattttattaacgattactatttaaatcttatggattggagtgcc
gacaatatagtggctgtggccttgggcagttgcgtctatttgtggaacgcacagaccgga
aatatcgagcagcttacggagtttgaggagggcgactacgcaggctcgctatcgtggatc
caggaggggcagatacttgccatcggcaacagcaccggtgccgtggagctgtgggactgc
tccaaagtgaagcgtctgcgagtgatggatggacacagtgcccgagtgggatccttggcc
tggaactcattcctggtttcctctggcagccgggatggcaccattgtccaccacgatgtg
cgtgcacgtgagcacaagctttccacattgtccggacacacgcaggaggtttgcggccta
aagtggtccacggatttcaagtatttggctagcggaggcaacgacaatctggtgaatgtt
tggtcggcggccagcggtggcgtgggaactgccaccgatcccttgcacaaattcaacgac
catcaagctgcagtgcgtgccttggcctggtgtccctggcaaccaagtactctagcctct
ggaggcggcaccgccgatcgctgcatcaagttctggaatgtgaacaatggcactttaatg
aaatccgtggactccaagtcgcaggtctgttctctgctcttttctcgccactacaaggag
ctgatctctgcgcatggttttgctaacaaccaactgaccatttggaaatacccaacaatg
gtgaagcaagccgatttgactggacacacgtcacgagttctccagatggccatgtctccg
gacggcagcacagtgatcagcgccggagctgatgaaaccctgcgtctttggaactgcttc
gctcccgatccgttggcgtccaagaaggcagtttcgaccagcaagggcaaacagagcgtg
ttccgacagagcatccgttga

DBGET integrated database retrieval system