KEGG   Drosophila melanogaster (fruit fly): Dmel_CG42829
Entry
Dmel_CG42829      CDS       T00030                                 

Gene name
CadN2
Definition
(RefSeq) Cadherin-N2, isoform C
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: Cadherin Laminin_G_2 Cadherin_C Laminin_G_1 EGF hEGF Cadherin_3 EGF_2 EphA2_TM PKD_2 Chordopox_A13L
Other DBs
NCBI-GeneID: 35071
NCBI-ProteinID: NP_001036368
FlyBase: FBgn0262018
UniProt: Q9VJB6
Position
2L
AA seq 1799 aa
MVDPLKIFWVLTNSTYLVTKFVRIGIADKNDSPPYFDRFLYETEIDENADLQSTVLTVNA
KDHNESTNIRYQITGGNIGNAFAVQNTTGVIYVASPLDYETRPRYELRLEATRNRKNNYT
TVVINVRDVNDNPPVFDRQTYRTQITEEDDRNLPKRILQVTATDGDVDRPINIVYFLTGQ
GIDPDNPANSKFDINRTTGDIFVLKPLDRDQPNGRPQWRFTVFAQDEGGEGLVGYADIQV
NLKDINDNAPQFPQGIYFGNVTENGTAGSSVMTMSAVDYDDPNESTNAKLIYSIEKNVIE
EETGAPIFEIEPETGLIKTAVCCLDRERTPDYSIQVVAMDGGGLKGTGTASIRVKDLNDM
PPQFTKDEWVTEVDETNGTYIPETPILTVTVQDEDETNTFQYKVVPNSGFGADKFAMVRN
GDGTGSLKIIQPLDYEDPLQSSGFRFRIQVNDKGDDGPGGSDKYHVAYSWVVVKLRDIND
NVPKFDREHIEVSIYEDTKVGTILEQFKATDADQGGHSKVAYKIVRSTNRKRQFAISDRG
AVSIQRPLDRETQDRHHIQILAIDDGSPARTATATLTVIVKDVNDNAPTFAQDYKPTLPE
NVSGKKILEVAAKDPDDRLRGNGGPFTFRLDPLASDEIKAGFKVEYDRRGDNENGVAIIS
SLRPFDREAQKSYAIPIEIKDNGAPAMTGTSTLTVTIGDVNDNKMQPGSKSVLVYNYQGQ
SQDTPIGRVYVNDPDDWDVPDKKYYWEVQEHQRFKLDTDTGILTMRAGTRRGRYQLRFKV
YDREHGQEDIPANLSVTVRDITAEAVQQAGSMRLSHITDEDFVRTWNPVKNQVEPSKLER
FRNKLAELLYTDRDNVDVFSVQLKEGSPYPLTDVHFAARSATQQPYFKAVRLNGVVQMHR
EEIEKDVGLNITMVNINECLHEGKGKCGSNSCTSKVELGKKPYTVSVNRTALVGVRLDIS
AQCVCRARNFTHQDHNCRTHLCYNGGRCVETRNGPKCVACPVGYNGPRCQQSTRSFRGNG
WAWYPPLQLCQESHLSLEFITRVADGLILYNGPIVPPKPEETVISDFIALELEQGYPRLL
IDFGSGTLELRVKTKKTLDDGVWHRLDIFWDTENVRMVVDFCRTALVSEMEDGTPPEFDD
NACQARGQIPPFAESLNLNQPLQLGGLYRQHFDQTLYNWQYAFSSKGFDGCIRNVIHNSE
HYDLAFPALARNSFPACPQTDEVCLKTEHTARCWEHGNCVASLVQAKCHCQPGWMGPGCN
VPTIPTTFKAQSYVKFALSFEPDRFSTQLQLRFRTREQGGELFRVSDQHHREYAILELRR
GHLQFRYNLNSMRNEEQLLTLTAIAVNDGQWHVIRISRYGSAALMELDGGESRRYNESFH
FTGHQWLTIDKQEGVYAGGKAEYTGIKTFEVQSDFQRSCLDDIRLDGKHLPLPPAMNGTQ
WGQATMARNLERNCPSNRPCSNVICPDPFDCVDLWNEYECTCSEGRIMSSDTKGCVDRNE
CLDLPCLNGATCINLEPRLRYRCICPEGYWGENCELVQEGQRLKLSMGALGAIFVCLIII
LILALIFVLYSRKRKTTKKKKRSGPEKDVRETVISYEDEGGGEDDMTAFDITPLQIPISA
QGGPPDIAACKMPIIYPVMTLLPPGQELNVAYLMEERKQRIDKDNNAPPFDDLRNFTFEG
SGSIAESLSSLASGTDDENQDFNYLQNWGPRFNALAAMYVHDKAKASSQLPSDGGGGSGD
GPGPGASSSSPLGGGGTGGGSGIPGNVLAVVATGSGAGPGGGGGSSGLMPLPEVDKVVL
NT seq 5400 nt   +upstreamnt  +downstreamnt
atggtcgatccattaaaaatcttttgggttttgacaaatagcacctatttggttacaaaa
tttgtacgcattggtattgccgacaaaaacgattcaccgccgtatttcgatagatttctg
tacgaaactgaaatcgatgaaaatgccgacttgcagagcactgtcctcactgtcaacgcc
aaggatcacaatgagtcgacgaatattcgataccagatcacaggcggtaacataggcaat
gcatttgccgtacagaacaccaccggtgtcatttacgtggcaagtccacttgactacgaa
acgaggccaaggtatgaactgcgcctggaggcaactcgcaatcgcaaaaataactacacc
accgttgtgatcaacgttcgcgatgtcaacgataatccaccggtattcgatcgtcaaaca
tatcgtacacaaatcactgaggaagacgatcgcaatctgcccaaacgcattctgcaggtc
acagccaccgatggcgatgtagatagaccaataaatattgtatatttcctgactggtcag
ggcatcgaccctgataatccagcgaatagtaaatttgatataaatcgcacgacgggcgat
atttttgttctcaagcccctggaccgagatcagcccaatgggaggccacagtggcgcttt
acagtatttgcccaggacgagggtggcgaggggctggtaggctatgcggacatccaggtg
aacctaaaggacatcaacgacaatgcgccgcagtttccgcagggcatctactttggtaac
gtgaccgagaacggcaccgccggcagttcggtgatgaccatgtccgccgtcgactacgac
gatcccaacgagagcaccaatgccaagctaatctactcgattgagaagaacgtcatcgag
gaggagacgggggcgcccatctttgaaatcgagccggagacgggactcatcaaaacggct
gtctgttgtctggacagggagcgaacgcccgactactcgattcaggtggtggccatggac
ggcggtggacttaaaggtactggcaccgcctccattcgcgtcaaggacctcaacgacatg
ccgccgcagttcaccaaggacgagtgggttacggaggtggacgaaacgaatggcacttac
atcccagagacgcccattctcacggtgacggttcaggatgaggacgaaacgaacacgttc
caatacaaggtggtgccaaacagtggtttcggggcggataaatttgcgatggttcgcaat
ggcgatggaacgggctcgttgaaaatcatacaacccctggactacgaggatccgctgcaa
agtagtggattccggttccgcattcaggtcaacgataaaggcgacgatggacccggtgga
agtgacaagtaccatgtggcctattcgtgggtggtggtgaagctgcgagatattaacgac
aatgtgccaaaattcgatcgggagcatatagaggtctctatctatgaggatacgaaagtg
ggaaccattctcgagcaatttaaggccacggatgccgaccagggcggtcactccaaagta
gcatacaaaatagttcgttccacaaatcgtaaaagacaatttgccattagtgatagagga
gcagtgagcatacaaagacctttggatcgggaaactcaggatcgacaccatattcagatt
ttagccattgacgatggcagtcctgctcgaactgcaaccgcaactctaaccgtgatagtc
aaggatgtcaatgataacgcgccgacttttgcccaggactataagcccactttgcctgag
aatgtgtctggtaaaaaaattcttgaggtggcagccaaggatcccgatgatcgactaagg
ggcaacggaggaccctttacctttcgattggatcctttggccagcgatgaaataaaagcg
ggctttaaagtggagtatgaccgaagaggtgacaatgaaaatggggtggccatcatttca
tccctccgtccctttgatcgcgaggcgcaaaagagctatgccattcccattgagatcaag
gataatggagctcctgccatgacgggcaccagtactctaaccgttaccattggcgatgta
aatgataataaaatgcagcccggcagcaaatccgtattggtatataactaccaaggacag
tcgcaggatacgccgattggcagggtctatgtcaatgatcccgatgactgggatgtgccg
gataagaagtactactgggaggttcaggagcaccaaagatttaaactggatacggatact
ggtattttaaccatgagagcgggaacgagaagaggtcgctatcagttgcggttcaaggtc
tacgatcgtgagcatggtcaggaggatattcctgccaatctcagcgttacagtgcgcgac
ataacagcagaggccgttcagcaagctggttcaatgaggttgtctcacataaccgatgag
gatttcgttagaacttggaacccggttaagaatcaagtagagccctccaagctagagaga
tttcgcaacaagctggccgaattattgtacaccgatagagacaatgtcgacgtattcagt
gtgcaacttaaggaaggttctccttatcccctaaccgatgtccactttgcagctcgatct
gctactcagcaaccgtatttcaaagcagtccgcctaaatggtgtggtccaaatgcatcgt
gaggagattgaaaaagacgtgggcctgaacatcaccatggtcaatataaatgagtgcttg
catgaaggtaaagggaagtgtggctccaattcctgtacctccaaagttgagttgggcaaa
aaaccctatacggttagtgtaaatcgcactgctttggtgggcgttcgtttggacattagt
gctcaatgtgtttgccgggcgaggaacttcacccaccaggatcacaattgcaggacccac
ctttgttataatggcggtcggtgtgtggaaacccgaaatggtccgaaatgcgtggcctgt
ccggtggggtacaatggcccgcgatgtcagcaatccacgagaagttttcgcggcaatggc
tgggcctggtatcctccattacaactctgccaggaatcccatctcagcttggaattcatc
actcgcgttgcagacggcttgatactctacaatggacccattgtcccaccaaagccagag
gaaaccgtgatcagcgactttatagctctcgaactggaacagggctatccgcgtctactc
atcgatttcggctcgggaactttggagttgagggtaaagaccaagaaaacgctggatgat
ggggtctggcatcgattggatattttttgggataccgaaaatgtccggatggttgtggac
ttttgtcgcactgccttggtctccgaaatggaggatggcactccgccggaattcgatgat
aacgcctgtcaggcgagaggacaaattccgccatttgctgagtccctaaatctaaatcaa
ccccttcagttgggcggactctatagacagcacttcgatcaaaccctttacaattggcag
tatgccttcagctccaagggctttgatggttgtatacgcaacgttatccacaactcagag
cactatgatttggcttttccggctttggccaggaatagttttcccgcctgtccgcagacc
gacgaagtttgcctgaaaaccgagcacacagctcgttgttgggagcatggaaactgtgtg
gccagcttggttcaggccaagtgccattgccagccgggttggatgggtcctggctgtaat
gtacccaccattccgacgactttcaaggcccagagctatgtgaaattcgccctcagcttt
gagcccgacagattttccacccagttgcagctgagatttcgaactcgagagcagggaggc
gaacttttccgggttagtgatcaacaccacagggagtacgccatactggaacttcgaaga
ggccacctgcagttccgctataatctgaactccatgagaaacgaggagcagctgctcacc
ctaaccgcaatcgcagtgaacgatggccaatggcatgtgattcgcattagtcgatatgga
tcggcagctctaatggaactggatggcggggagtcgcggcgctacaacgagtcctttcac
ttcacagggcatcagtggctgaccatcgacaagcaggagggtgtttatgcgggcggcaag
gccgagtatacgggaatcaagacctttgaggtgcagtccgatttccagagaagctgcttg
gacgacatcaggctggatggaaagcacttgcccctgccgcccgccatgaatggcacccaa
tggggccaggcgacgatggcccgcaacctggagcgcaactgcccctcgaacaggccgtgc
tcgaatgtcatctgtcccgatccctttgactgcgtcgacttgtggaacgaatacgagtgc
acttgcagcgagggtcgcatcatgtcctcggacaccaagggatgtgtggaccgcaacgag
tgcctggacctgccatgtctgaacggagccacctgcatcaatctggagccccggctgcgg
taccgatgcatttgcccggagggctactggggcgaaaactgcgagctggtgcaggaggga
cagcgcctgaagctgagcatgggcgccctgggggccatattcgtttgcctgattatcata
ctgattctcgcactgatcttcgtgctatatagtcgcaaacgcaagacgaccaagaagaag
aagcgctccggacccgagaaggatgtccgcgagacggtcatcagctacgaggacgagggt
ggcggcgaggacgacatgacggccttcgacattacgccactgcaaataccaatcagcgca
cagggaggaccgccggacatcgccgcctgcaagatgcccataatctatcccgtgatgacg
ctgctgccacctggccaggaactgaacgtggcctatctgatggaggaacggaagcagcgc
atcgacaaggacaacaacgcaccgcccttcgacgacctgcggaacttcaccttcgagggc
agcggcagcatcgccgagtcactgagttcgctagcctccggcaccgatgatgagaatcaa
gactttaactatctacagaactggggtccacgtttcaatgccctggccgccatgtacgtg
cacgataaggcgaaagccagcagccagctgccgtcggatggcggaggaggatctggagat
ggacctggacctggagcctcatcatcatcgccgttgggaggcggtggcacgggaggtgga
tctgggattccaggcaatgtccttgccgtcgtcgcaacgggaagtggagcaggtcctgga
ggcggcggtggtagcagtgggttgatgccactgcccgaggtcgacaaagttgtattataa

DBGET integrated database retrieval system