KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4303
Entry
Dmel_CG4303       CDS       T00030                                 

Gene name
Bap60
Definition
(RefSeq) brahma associated protein 60kD
  KO
K11650  SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:dme03021]
    Dmel_CG4303 (Bap60)
   03036 Chromosome and associated proteins [BR:dme03036]
    Dmel_CG4303 (Bap60)
Transcription machinery [BR:dme03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     Dmel_CG4303 (Bap60)
Chromosome and associated proteins [BR:dme03036]
 Eukaryotic type
  Chromatin remodeling factors
   BAF complex
    Dmel_CG4303 (Bap60)
   PBAF complex
    Dmel_CG4303 (Bap60)
SSDB
Motif
Pfam: SWIB
Other DBs
NCBI-GeneID: 32268
NCBI-ProteinID: NP_511143
FlyBase: FBgn0025463
UniProt: Q9VYG2
Position
X
AA seq 515 aa
MSQRFAPGQAPVQSRYQPPPPAPGMRPYPPPGASFPPRGFPLHPNTTQPVPGTANVAGVP
GVPGVPGVPGPSLLQRAAQQPGFQSSLRGTGAGGGGVGSGGGSKRSNESRSLGGGGSKSD
FATAKKKKKLAEKILPQKVRDLVPESQAYMDLLTFERKLDATIMRKRLDIQEALKRPMKQ
KRKLRIFISNTFYPSKEPTNDGEEGAVASWELRVEGRLLEDGKGDPNTKIKRKFSSFFKS
LVIELDKELYGPDNHLVEWHRTHTTQETDGFQVKRPGDRNVRCTILLLLDYQPLQFKLDP
RLARLLGVHTQTRPVIISALWQYIKTHKLQDAHEREYINCDKYLEQIFSCQRMKFAEIPQ
RLNPLLHPPDPIVINHFIESGAENKQTACYDIDVEVDDTLKNQMNSFLMSTASQQEIQGL
DTKIHETVDTINQMKTNREFFLSFAKDPQMFIHRWIISETRDLKLMTDVAGNPEEERRAE
FYYQPWTHEAVSRYFFTKVNQKRAELEQALGIRNG
NT seq 1548 nt   +upstreamnt  +downstreamnt
atgtcgcaacgctttgcacctggccaagcgccggtgcagtcgcgttatcagccaccacca
ccggcgcccggcatgcgtccctatccgccgccaggcgcctcttttccaccgcgcgggttt
cccctgcatccgaacactactcaacctgttcccggcacggcgaacgtggccggggtaccg
ggagttcctggagtacccggcgtaccgggaccatcgctactgcagcgcgccgcccaacag
ccgggctttcagagcagccttcgcggtactggagccggaggtggcggtgttggatccggc
ggaggcagcaagaggtcaaatgaatcccgcagtttgggtggcggtggtagcaaaagtgat
tttgcgacggccaaaaagaaaaagaagctggccgaaaagatactgccgcagaaggtgcgg
gatctggtgcccgaatcgcaagcgtacatggatctgctgacgtttgagcgaaaactggat
gccaccataatgcgcaaacgtctggacatccaggaggccctcaagcgccccatgaagcag
aagcgcaagctgcgcatcttcatctcgaacacattctatcccagcaaggagcccacaaat
gatggcgaggagggcgccgttgcctcttgggaattgcgggtggagggtcgcctgttagag
gatggcaagggcgatcccaatacaaagatcaaacgcaagttttcgtcgtttttcaagtcg
ctggttatcgagctggataaggaactgtacggtccggacaaccatctggtcgagtggcat
cgcactcacaccacccaggagacggacgggttccaggtgaagcggccgggcgatcgcaat
gtgcgctgcaccatcctcctgctgcttgactaccagccgctgcagttcaagctggacccg
cgactcgccaggttgctgggcgtacacacacagaccaggccggtgatcatatccgccctg
tggcagtacatcaagacgcacaagctacaggatgcccacgagcgggagtacatcaattgc
gacaagtatctggagcagatattcagttgccagcggatgaagtttgccgagataccgcaa
cgcctcaatccgctgctgcatccgcccgatccgattgtgatcaatcatttcattgagagc
ggtgcagagaacaagcagactgcctgctacgacatcgatgtggaggtggatgatacgctc
aaaaaccagatgaacagcttcctgatgagcactgcgagccaacaggagatccaggggctg
gacaccaagatccacgagacggtggacacgatcaaccagatgaagacgaacagggagttc
ttcctaagcttcgccaaggatccacaaatgtttattcatcgctggatcatcagtgagacg
agggatttgaagctgatgaccgatgtagctggcaatccggaggaggagcgtcgggcggag
ttctattaccagccatggacgcacgaggccgtttcgcgctacttcttcaccaaggtcaac
cagaagcgggccgaattggagcaggcgctgggcatacgcaacggctag

DBGET integrated database retrieval system